Protein Info for SMc00825 in Sinorhizobium meliloti 1021

Annotation: glutamate--cysteine ligase precursor protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 457 TIGR01436: glutamate--cysteine ligase" amino acids 10 to 457 (448 residues), 617.6 bits, see alignment E=4.8e-190 PF04107: GCS2" amino acids 51 to 361 (311 residues), 274.5 bits, see alignment E=5.8e-86

Best Hits

KEGG orthology group: K01919, glutamate--cysteine ligase [EC: 6.3.2.2] (inferred from 100% identity to smk:Sinme_0479)

Predicted SEED Role

"Glutamate--cysteine ligase (EC 6.3.2.2)" in subsystem Glutathione: Biosynthesis and gamma-glutamyl cycle (EC 6.3.2.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q926D5 at UniProt or InterPro

Protein Sequence (457 amino acids)

>SMc00825 glutamate--cysteine ligase precursor protein (Sinorhizobium meliloti 1021)
MARDTTDQTPVTSVAELTAYLASGSKPKEKFRIGTEHEKFAFFKADNSPVPYFGDASIQA
LLNGMAERNGWEPIMDEGNVIGLAEPSGNGAISLEPGGQFELSGAPLENLHQTCKESNQH
LAVLREIAEPLGIRFLGIGGSPKWSFAETPRMPKSRYAIMTRYMPKVGSKGLDMMYRTCT
IQVNLDFSSEEDMRRKMQVSLKLQPLATALFASSPFTEGKPNGLLSWRGDIWRDTDNQRS
GLLPTAFKPDFGFSDYMEWALDVPMYFVVRGGHYHDCTHVTFRQFMNGALKGEIAEWQPT
MGDWTNHLSTLFPDVRLKRFLEMRGADGGPWRRICALPAFWVGLLYDDEALSAAEELTRD
WGYEEVLALRDAVPAKALAAEFRSRSLFDVAREVLTISRNGLKRRNRLNGDGIDESQFLA
PLDEVLAKKATLAEDMLSLYHGRWNESVEPVFADYQY