Protein Info for SMc00815 in Sinorhizobium meliloti 1021

Annotation: inosine 5'-monophosphate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00478: IMPDH
  • amino acids 13 to 485 (473 residues), 526.5 bits, E=5.9e-162
• TIGR01302: inosine-5'-monophosphate dehydrogenase
  • amino acids 13 to 466 (454 residues), 651.8 bits, E=2.8e-200
• PF00571: CBS
  • amino acids 98 to 154 (57 residues), 42.1 bits, 1.8e-14
  • amino acids 162 to 212 (51 residues), 37.6 bits, 4.4e-13
• PF03060: NMO
  • amino acids 221 to 384 (164 residues), 36.6 bits, E=7.3e-13

Best Hits

Swiss-Prot: 57% identical to IMDH_HAEIN: Inosine-5'-monophosphate dehydrogenase (guaB) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K00088, IMP dehydrogenase [EC: 1.1.1.205] (inferred from 100% identity to sme:SMc00815)

MetaCyc: 57% identical to inosine 5'-monophosphate dehydrogenase (Escherichia coli K-12 substr. MG1655)
IMP dehydrogenase. [EC: 1.1.1.205]

Predicted SEED Role

"Inosine-5'-monophosphate dehydrogenase (EC 1.1.1.205)" in subsystem Purine conversions (EC 1.1.1.205)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (23/26 steps found)
• purine nucleotides degradation II (aerobic) (11/11 steps found)
• superpathway of purine nucleotide salvage (13/14 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis I (6/6 steps found)
• purine nucleotides degradation I (plants) (10/12 steps found)
• adenosine nucleotides degradation I (7/8 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis II (7/8 steps found)
• guanosine ribonucleotides de novo biosynthesis (4/4 steps found)
• inosine 5'-phosphate degradation (4/4 steps found)
• superpathway of purines degradation in plants (14/18 steps found)
• ureide biosynthesis (6/7 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Drug metabolism - other enzymes
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.205

Use Curated BLAST to search for 1.1.1.205

Sequence Analysis Tools

See Q92RT5 at UniProt or InterPro

Protein Sequence (500 amino acids)

>SMc00815 inosine 5'-monophosphate dehydrogenase (Sinorhizobium meliloti 1021)
MARIIETATGLEALTFDDVLLQPGHSEVMPGQTNIATRIAQDIELNLPILSAAMDTVTEA
RLAIAMAQAGGIGVIHRNLTPAEQAEEVRQVKKFESGMVVNPVTIGPDATLADALGLMKA
HGISGIPVVENGGLGGQTQGRLVGILTNRDVRFASDPSQKIYELMTRENLITVKESVDQQ
EAKRLLHKHRIEKLLVVDPEGRCVGLITVKDIEKSQLNPNAAKDAQGRLRAAAAVSVGDD
GFERAERLIDAGVDMIVVDTAHGHSQRVLDAVARVKKLSNSVRIMAGNVATGDGTKALID
AGADAVKVGIGPGSICTTRIVAGVGVPQLAAIMAAVDAAQAAGIPIIADGGIKFSGDVAK
AIAAGASAVMIGSLLAGTEESPGEVFLYQGRSFKAYRGMGSVGAMARGSADRYFQAEVRD
TLKLVPEGIEGQVPYKGPVSGVLHQLAGGLRASMGYVGGATIKDYQERATFVRISGAGLR
ESHAHDVTITRESPNYPGGA