Protein Info for SMc00811 in Sinorhizobium meliloti 1021

Annotation: cell division protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 245 PF01728: FtsJ" amino acids 49 to 227 (179 residues), 183 bits, see alignment E=2.6e-58

Best Hits

Swiss-Prot: 100% identical to RLME_RHIME: Ribosomal RNA large subunit methyltransferase E (rlmE) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K02427, ribosomal RNA large subunit methyltransferase E [EC: 2.1.1.-] (inferred from 100% identity to sme:SMc00811)

Predicted SEED Role

"Heat shock protein FtsJ/RrmJ @ Ribosomal RNA large subunit methyltransferase E (EC 2.1.1.-)" (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92RT9 at UniProt or InterPro

Protein Sequence (245 amino acids)

>SMc00811 cell division protein (Sinorhizobium meliloti 1021)
MTKSPIGGNRSGRKLGQKVKKGKLKASSRRWIERHINDPYVQRAQLEGYRARAAFKLLEI
DEKHKILAGAKRIIDLGAAPGSWSQIAAKVTNSTDADPRVAAIDFLEMDPIPGVRFLQMD
FLDPEAPENLKQAIGGAPDIVLSDMAAPTTGHRQTDHIRTMHLCEVAAHFAVEVLAEGGH
FLAKTFQGGTERDLLNMLKQNFRQVVHVKPASSRAESVEMFLLAKGFKGRHALESDEPAE
GAAEE