Protein Info for SMc00793 in Sinorhizobium meliloti 1021

Annotation: permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 376 transmembrane" amino acids 39 to 57 (19 residues), see Phobius details amino acids 63 to 81 (19 residues), see Phobius details amino acids 93 to 117 (25 residues), see Phobius details amino acids 174 to 196 (23 residues), see Phobius details amino acids 237 to 257 (21 residues), see Phobius details amino acids 264 to 287 (24 residues), see Phobius details amino acids 294 to 312 (19 residues), see Phobius details amino acids 332 to 362 (31 residues), see Phobius details PF01594: AI-2E_transport" amino acids 47 to 365 (319 residues), 119.4 bits, see alignment E=9.7e-39

Best Hits

KEGG orthology group: None (inferred from 100% identity to sme:SMc00793)

Predicted SEED Role

"transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92RV3 at UniProt or InterPro

Protein Sequence (376 amino acids)

>SMc00793 permease (Sinorhizobium meliloti 1021)
MDTAGRTTAERRRKREAEREIALAEASAIVARKRDNIDLAGAWSVIGLFVIACAAVVYTM
EAILLPITLAVVIGIVLGRAADELARFGLPPMFGGLLLALCFLLGLSYLVNAILWPITEV
AREAPRLVEGLMERILPYLQRFEWVNVALARGSGEEAFADVIVKNAGPLIGGAAASLTPA
LVQTLIFLAALVLFLLGRVQLRSTIILAFPSREGRLSAIRVMNALEDALTQYFSTASLIY
LALGFITMVIALVGGLAMPPLWGLFAFVSSFIPYLGVTFMTLSLVVGGLMTHDALIVAIA
PAVAFFTVHLAMENLLVPAILGQRFDINPFLVFVAIIFWTWMWGAVGALLAFPLSLIAMI
IFEQILLPQPERQLPG