Protein Info for SMc00782 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 370 transmembrane" amino acids 36 to 56 (21 residues), see Phobius details amino acids 78 to 98 (21 residues), see Phobius details amino acids 104 to 125 (22 residues), see Phobius details amino acids 146 to 171 (26 residues), see Phobius details amino acids 206 to 233 (28 residues), see Phobius details amino acids 247 to 271 (25 residues), see Phobius details amino acids 300 to 318 (19 residues), see Phobius details PF05987: DUF898" amino acids 24 to 363 (340 residues), 385.7 bits, see alignment E=9.6e-120

Best Hits

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_0430)

Predicted SEED Role

"Thymidylate kinase (EC 2.7.4.9)" (EC 2.7.4.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.4.9

Use Curated BLAST to search for 2.7.4.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92RW3 at UniProt or InterPro

Protein Sequence (370 amino acids)

>SMc00782 hypothetical protein (Sinorhizobium meliloti 1021)
MAESLPAQNAGERSFGRAAEGDIQRLSFTGSGSEYFGIWIVNILLTIITLGIYSAWAKVR
RNRYFYGNTILLGRGFEYHASGGQILIGRLIVFAYLVLYNIMLTFVPLVGIGLGVLMLFF
VPWLVARGLRFSARVTSYRNVRFDFVGGAGGAFLAFIIGPVLAALTLGILAPLASRWSYR
YVGNNLRYGQKPFSTDPPLGRLYRTWVAPAAVLVLGMLIGGFFVFLGVALVNAVAEGAEL
SSQALQGFTGLLLVLGYLLLFAIFGLAALIYRAGVRNVAWSATSFDGRHRLLSDLSRLRY
TWIAVSNLIVTLVTLGLMRPWAAVRMARYVNEHTGVRFEGDVGELLSQIAQEGSAVGAEF
MDIEGFDFGF