Protein Info for SMc00770 in Sinorhizobium meliloti 1021

Annotation: putrescine-binding periplasmic protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 364 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF01547: SBP_bac_1" amino acids 36 to 298 (263 residues), 70.9 bits, see alignment E=3.9e-23 PF13416: SBP_bac_8" amino acids 41 to 328 (288 residues), 106.7 bits, see alignment E=4e-34 PF13343: SBP_bac_6" amino acids 76 to 310 (235 residues), 72.3 bits, see alignment E=9.3e-24

Best Hits

Swiss-Prot: 53% identical to SPUD_PSEAB: Putrescine-binding periplasmic protein SpuD (spuD) from Pseudomonas aeruginosa (strain UCBPP-PA14)

KEGG orthology group: K11073, putrescine transport system substrate-binding protein (inferred from 100% identity to smk:Sinme_0417)

MetaCyc: 51% identical to putrescine ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-25-RXN [EC: 7.6.2.11, 7.6.2.16]

Predicted SEED Role

"Putrescine ABC transporter putrescine-binding protein PotF (TC 3.A.1.11.2)" in subsystem Polyamine Metabolism (TC 3.A.1.11.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.11 or 7.6.2.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92RX4 at UniProt or InterPro

Protein Sequence (364 amino acids)

>SMc00770 putrescine-binding periplasmic protein (Sinorhizobium meliloti 1021)
MSKLIVATLTTAVLAGSTILAFAQERVVNVYNWSDYIDDSILEEFTKETGIKVVYDVFDS
NEILETKLLAGGSGYDVVVPTAYFLQRQIAAGVFQKLDKSKLPNISNMWDMVMERTAQYD
PGNEYAVDYMWGTTGIGYNVEKMKEILGTDEKPNWDVIFDPEIAAKFKDCGIHLLDSPTD
IMPSALAYLGLNPDSHDQADLEKAADLLMKVRPNIRKFHSSEYINALANGDICLAVGFSG
DVFQARDRAAEAKAGVTVDYSIPEQGAQMWFDMLAIPADAPHVAEAHEFINYMMKPEVIA
KASNYVFYANGNKASQQFLDKEVLEDTAIYPSDAVMQKLFTTTPFEAKEQRVLTRLWTRI
VTGQ