Protein Info for SMc00744 in Sinorhizobium meliloti 1021

Annotation: transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 399 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 49 to 69 (21 residues), see Phobius details amino acids 81 to 101 (21 residues), see Phobius details amino acids 107 to 127 (21 residues), see Phobius details amino acids 138 to 160 (23 residues), see Phobius details amino acids 167 to 187 (21 residues), see Phobius details amino acids 208 to 232 (25 residues), see Phobius details amino acids 249 to 268 (20 residues), see Phobius details amino acids 280 to 299 (20 residues), see Phobius details amino acids 309 to 332 (24 residues), see Phobius details amino acids 343 to 363 (21 residues), see Phobius details amino acids 370 to 387 (18 residues), see Phobius details TIGR00710: drug resistance transporter, Bcr/CflA subfamily" amino acids 14 to 386 (373 residues), 320.2 bits, see alignment E=1.3e-99 PF07690: MFS_1" amino acids 25 to 353 (329 residues), 139.9 bits, see alignment E=1e-44 PF00083: Sugar_tr" amino acids 51 to 122 (72 residues), 26.9 bits, see alignment E=2.4e-10

Best Hits

KEGG orthology group: K07552, MFS transporter, DHA1 family, bicyclomycin/chloramphenicol resistance protein (inferred from 100% identity to smk:Sinme_2683)

Predicted SEED Role

"Bicyclomycin resistance protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92MI8 at UniProt or InterPro

Protein Sequence (399 amino acids)

>SMc00744 transporter (Sinorhizobium meliloti 1021)
MPTKNHVWRYSLPAALLLMAPFDILASLAMDIYLPIVPAMPGILGTSPAVVQLTLSLYMV
MLGLGQIVFGPVSDRIGRRPVLIGGAMLFAAASFCLAASSSAIPFVAFRFLQAVGASAAL
VATFATIRDVYADRPESVVIYSLFSSILAFVPALGPITGAMLAERFGWRSIFVTLGALAI
IALLQALPRWHESRPSAAALSRHAFGPLLRSLAFWTYTLGFSAAMGTFFVFFSTSPRVLI
DKAGYSELQFSLAFATVAIVMIITARFAERFVSRWGTSGSLLRGMCMLLLGAALLIAGET
FGVPSSWTFVMPMWVMAVGIVFTVSVTANGALEDFGDMAGSAVAVYFCVQSLIVGTAGTL
LVIGLPGDSAWPLVVYASIMAGVVLIARRQLHSRRHVQA