Protein Info for SMc00733 in Sinorhizobium meliloti 1021

Annotation: short chain dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 277 PF08659: KR" amino acids 6 to 163 (158 residues), 27 bits, see alignment E=1e-09 PF00106: adh_short" amino acids 6 to 188 (183 residues), 131.9 bits, see alignment E=5.3e-42 PF01370: Epimerase" amino acids 7 to 163 (157 residues), 31.8 bits, see alignment E=2.5e-11 PF13460: NAD_binding_10" amino acids 12 to 137 (126 residues), 31.1 bits, see alignment E=5.4e-11 PF13561: adh_short_C2" amino acids 13 to 188 (176 residues), 99 bits, see alignment E=8.4e-32

Best Hits

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_2694)

Predicted SEED Role

"Short-chain dehydrogenase/reductase SDR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92MH8 at UniProt or InterPro

Protein Sequence (277 amino acids)

>SMc00733 short chain dehydrogenase (Sinorhizobium meliloti 1021)
MPDRPTIIVTGCSSGIGAYCARALQRDGWRVFATVRRPEDQAPLEAEGIETFIMDYTRPE
TIAALVEAVMALSGGRIDALFNNGAYGQAGAVEDLPTEALRLQLETNVIGWHDLTRRVIP
AMRARGHGRIVQCSSILGLVPYRWRGAYNASKFALEALSLTLRMELAGSGIGVSLIEPGP
IASKFTTNAIAYIERFIDLENSVHRAEYERQMRRLRGESKPAPGKLGPDAVYAALKHALT
ARRPRPHYIVTRPARQGALLKKLLPAALFYRIIGRLG