Protein Info for SMc00730 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 263 transmembrane" amino acids 16 to 35 (20 residues), see Phobius details amino acids 42 to 61 (20 residues), see Phobius details amino acids 80 to 100 (21 residues), see Phobius details amino acids 112 to 130 (19 residues), see Phobius details amino acids 136 to 155 (20 residues), see Phobius details amino acids 162 to 184 (23 residues), see Phobius details amino acids 198 to 217 (20 residues), see Phobius details PF01694: Rhomboid" amino acids 75 to 219 (145 residues), 121.6 bits, see alignment E=1.6e-39

Best Hits

KEGG orthology group: None (inferred from 100% identity to sme:SMc00730)

Predicted SEED Role

"FIG056164: rhomboid family serine protease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92JZ6 at UniProt or InterPro

Protein Sequence (263 amino acids)

>SMc00730 hypothetical protein (Sinorhizobium meliloti 1021)
MFIPLHDRNELKHIRMQYVTITLIVIDFVAWLAIGPVATEDFANAAILGLGYIPAIIFDY
ADLDPSLVIVPDEFTFVTYSFLHGDFMHLAMNMLFLWVFGDNVEDALGHFRFLVFYLLCA
AAGALAHGLLEPASEAPLIGASGAISGVVAAYFLLHPKVRVWVLVLFRIPLPLPAAIPLA
FWIGQQFFMFLADPGGGVSWSAHVGGIVAGLVLVVLLRRPGVPLFDRTIVTPRAVEHRER
TPEETSPVAAGASKPAPHWGRPT