Protein Info for SMc00727 in Sinorhizobium meliloti 1021
Annotation: 3-hydroxybutyryl-CoA dehydrogenase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 73% identical to HBD_BRADU: 3-hydroxybutyryl-CoA dehydrogenase (hbdA) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)
KEGG orthology group: K00074, 3-hydroxybutyryl-CoA dehydrogenase [EC: 1.1.1.157] (inferred from 100% identity to sme:SMc00727)MetaCyc: 55% identical to 3-hydroxybutyryl-CoA dehydrogenase (Clostridium acetobutylicum)
3-hydroxyacyl-CoA dehydrogenase. [EC: 1.1.1.35]
Predicted SEED Role
"3-hydroxybutyryl-CoA dehydrogenase (EC 1.1.1.157)" in subsystem Acetyl-CoA fermentation to Butyrate or Butanol Biosynthesis or Polyhydroxybutyrate metabolism (EC 1.1.1.157)
MetaCyc Pathways
- oleate β-oxidation (29/35 steps found)
- photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (22/26 steps found)
- superpathway of glyoxylate cycle and fatty acid degradation (12/14 steps found)
- 1-butanol autotrophic biosynthesis (engineered) (21/27 steps found)
- (R)- and (S)-3-hydroxybutanoate biosynthesis (engineered) (5/5 steps found)
- adipate degradation (5/5 steps found)
- benzoyl-CoA biosynthesis (3/3 steps found)
- fatty acid salvage (5/6 steps found)
- glycerol degradation to butanol (12/16 steps found)
- adipate biosynthesis (4/5 steps found)
- fatty acid β-oxidation I (generic) (5/7 steps found)
- pyruvate fermentation to butanol II (engineered) (4/6 steps found)
- fatty acid β-oxidation II (plant peroxisome) (3/5 steps found)
- glutaryl-CoA degradation (3/5 steps found)
- pyruvate fermentation to hexanol (engineered) (7/11 steps found)
- 2-methyl-branched fatty acid β-oxidation (9/14 steps found)
- L-glutamate degradation V (via hydroxyglutarate) (6/10 steps found)
- methyl ketone biosynthesis (engineered) (3/6 steps found)
- phenylacetate degradation I (aerobic) (5/9 steps found)
- superpathway of Clostridium acetobutylicum acidogenic fermentation (5/9 steps found)
- valproate β-oxidation (5/9 steps found)
- 4-hydroxybenzoate biosynthesis III (plants) (2/5 steps found)
- pyruvate fermentation to butanol I (4/8 steps found)
- superpathway of phenylethylamine degradation (6/11 steps found)
- benzoyl-CoA degradation I (aerobic) (3/7 steps found)
- fatty acid β-oxidation VI (mammalian peroxisome) (3/7 steps found)
- pyruvate fermentation to butanoate (3/7 steps found)
- 3-hydroxypropanoate/4-hydroxybutanate cycle (10/18 steps found)
- 3-phenylpropanoate degradation (4/10 steps found)
- superpathway of Clostridium acetobutylicum solventogenic fermentation (6/13 steps found)
- benzoate biosynthesis I (CoA-dependent, β-oxidative) (3/9 steps found)
- 2-methylpropene degradation (2/8 steps found)
- superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (8/17 steps found)
- L-glutamate degradation VII (to butanoate) (4/12 steps found)
- methyl tert-butyl ether degradation (2/10 steps found)
- L-tryptophan degradation III (eukaryotic) (3/15 steps found)
- crotonate fermentation (to acetate and cyclohexane carboxylate) (3/16 steps found)
- benzoate fermentation (to acetate and cyclohexane carboxylate) (3/17 steps found)
- toluene degradation VI (anaerobic) (3/18 steps found)
- cholesterol degradation to androstenedione I (cholesterol oxidase) (2/17 steps found)
- androstenedione degradation I (aerobic) (6/25 steps found)
- platensimycin biosynthesis (6/26 steps found)
- cholesterol degradation to androstenedione II (cholesterol dehydrogenase) (2/22 steps found)
- superpathway of testosterone and androsterone degradation (6/28 steps found)
- androstenedione degradation II (anaerobic) (4/27 steps found)
- superpathway of cholesterol degradation I (cholesterol oxidase) (8/42 steps found)
- superpathway of cholesterol degradation II (cholesterol dehydrogenase) (8/47 steps found)
- superpathway of cholesterol degradation III (oxidase) (4/49 steps found)
KEGG Metabolic Maps
- Benzoate degradation via CoA ligation
- Bile acid biosynthesis
- Biosynthesis of plant hormones
- Butanoate metabolism
- Caprolactam degradation
- Fatty acid elongation in mitochondria
- Fatty acid metabolism
- Geraniol degradation
- Lysine degradation
- Tryptophan metabolism
- Valine, leucine and isoleucine degradation
Isozymes
Compare fitness of predicted isozymes for: 1.1.1.35
Use Curated BLAST to search for 1.1.1.157 or 1.1.1.35
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q92MH3 at UniProt or InterPro
Protein Sequence (290 amino acids)
>SMc00727 3-hydroxybutyryl-CoA dehydrogenase (Sinorhizobium meliloti 1021) MIKTVGIIGAGQMGCGIAHVSAAAGYKVQLYDIAADRIEAGLATINGNLARQVSSGKMSD EDRKRALSLIKGSGDINDLAQADLVIEAVTEDETVKRKIYGQVCPVMRPDAILATNTSSL SITRLASATDRPERFMGIHFMNPVPVMKLVELVRGIATEEETFKAAKEFVAHLDKTVTVA EDFPAFIVNRILLPMINEAIYTLYEGVGTVDAIDTAMKLGANHPMGPLQLADFIGLDTCL SIMQVLHDGLADSKYRPCPLLVKYVEAGWLGRKSGRGFYDYRGEVPVPTR