Protein Info for SMc00726 in Sinorhizobium meliloti 1021

Annotation: thiol:disulfide interchange redox-active center transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 224 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF08534: Redoxin" amino acids 84 to 213 (130 residues), 61.2 bits, see alignment E=2e-20 PF00578: AhpC-TSA" amino acids 86 to 193 (108 residues), 48.3 bits, see alignment E=1.9e-16 PF13905: Thioredoxin_8" amino acids 99 to 193 (95 residues), 31.5 bits, see alignment E=3.8e-11 PF00085: Thioredoxin" amino acids 100 to 144 (45 residues), 27.9 bits, see alignment 4e-10

Best Hits

Swiss-Prot: 49% identical to TLPA_BRADU: Thiol:disulfide interchange protein TlpA (tlpA) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_2701)

Predicted SEED Role

"Thiol:disulfide oxidoreductase TlpA" in subsystem Biogenesis of c-type cytochromes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92MH2 at UniProt or InterPro

Protein Sequence (224 amino acids)

>SMc00726 thiol:disulfide interchange redox-active center transmembrane protein (Sinorhizobium meliloti 1021)
MPDQKKRPPALKLFALAALLGVIAGAAAVYVKETGSGNGGVTPTADASCPLAGQKVASLT
PVMRGQVAAMTPADKARPIGGLDFAGPDGKPLTLAAFAGKTVLVNLWATWCVPCREEMPA
LNALQQTLGGDRFEVVAINIDTGADDKPKAFLDEVGVHALGYYRDASMGVFNTLKKEGLA
FGLPATLLLDEKGCLLGSMNGPAVWDSDDAKNLIEAALAPPAGS