Protein Info for SMc00719 in Sinorhizobium meliloti 1021

Annotation: hypoxanthine-guanine phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 181 TIGR01203: hypoxanthine phosphoribosyltransferase" amino acids 11 to 176 (166 residues), 171.2 bits, see alignment E=7.8e-55 PF00156: Pribosyltran" amino acids 12 to 162 (151 residues), 93.3 bits, see alignment E=5.1e-31

Best Hits

Swiss-Prot: 37% identical to HPRT_BUCAI: Hypoxanthine phosphoribosyltransferase (hpt) from Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)

KEGG orthology group: K00760, hypoxanthine phosphoribosyltransferase [EC: 2.4.2.8] (inferred from 100% identity to sme:SMc00719)

MetaCyc: 38% identical to hypoxanthine-guanine phosphoribosyltransferase (Arabidopsis thaliana col)
Hypoxanthine phosphoribosyltransferase. [EC: 2.4.2.8]; 2.4.2.8 [EC: 2.4.2.8]

Predicted SEED Role

"Hypoxanthine-guanine phosphoribosyltransferase (EC 2.4.2.8)" in subsystem Purine conversions (EC 2.4.2.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92MG7 at UniProt or InterPro

Protein Sequence (181 amino acids)

>SMc00719 hypoxanthine-guanine phosphoribosyltransferase (Sinorhizobium meliloti 1021)
MPVVRGKNIEVLYSAETIAARNQEMAADIVRGPHKDLLVISILKGSFIFAADLIRAMHAA
GLAPEVEFITLSSYGTGTESKGVRITKDIDSDVRDRDVLLIDDILESGRTLRFAKELLLE
RGARNVTIAVLLDKRVKRRVDLEADYVGFECPDHFVVGYGMDVAYAFRELPFVGVVTGDA
T