Protein Info for SMc00719 in Sinorhizobium meliloti 1021

Annotation: hypoxanthine-guanine phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01203: hypoxanthine phosphoribosyltransferase
  • amino acids 11 to 176 (166 residues), 171.2 bits, E=7.8e-55
• PF00156: Pribosyltran
  • amino acids 12 to 162 (151 residues), 93.3 bits, E=5.1e-31

Best Hits

Swiss-Prot: 37% identical to HPRT_BUCAI: Hypoxanthine phosphoribosyltransferase (hpt) from Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)

KEGG orthology group: K00760, hypoxanthine phosphoribosyltransferase [EC: 2.4.2.8] (inferred from 100% identity to sme:SMc00719)

MetaCyc: 38% identical to hypoxanthine-guanine phosphoribosyltransferase (Arabidopsis thaliana col)
Hypoxanthine phosphoribosyltransferase. [EC: 2.4.2.8]; 2.4.2.8 [EC: 2.4.2.8]

Predicted SEED Role

"Hypoxanthine-guanine phosphoribosyltransferase (EC 2.4.2.8)" in subsystem Purine conversions (EC 2.4.2.8)

MetaCyc Pathways

• superpathway of purine nucleotide salvage (13/14 steps found)
• adenine and adenosine salvage III (4/4 steps found)
• adenine salvage (3/3 steps found)
• guanine and guanosine salvage I (2/2 steps found)
• guanine and guanosine salvage II (2/2 steps found)
• xanthine and xanthosine salvage (2/2 steps found)
• superpathway of guanine and guanosine salvage (2/3 steps found)

KEGG Metabolic Maps

• Drug metabolism - other enzymes
• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.8

Sequence Analysis Tools

See Q92MG7 at UniProt or InterPro

Protein Sequence (181 amino acids)

>SMc00719 hypoxanthine-guanine phosphoribosyltransferase (Sinorhizobium meliloti 1021)
MPVVRGKNIEVLYSAETIAARNQEMAADIVRGPHKDLLVISILKGSFIFAADLIRAMHAA
GLAPEVEFITLSSYGTGTESKGVRITKDIDSDVRDRDVLLIDDILESGRTLRFAKELLLE
RGARNVTIAVLLDKRVKRRVDLEADYVGFECPDHFVVGYGMDVAYAFRELPFVGVVTGDA
T