Protein Info for SMc00717 in Sinorhizobium meliloti 1021
Annotation: ABC transporter ATP-binding protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 47% identical to FTSE_MYCTU: Cell division ATP-binding protein FtsE (ftsE) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
KEGG orthology group: K09812, cell division transport system ATP-binding protein (inferred from 98% identity to rhi:NGR_c27010)Predicted SEED Role
"Cell division transporter, ATP-binding protein FtsE (TC 3.A.5.1.1)" in subsystem Bacterial Cell Division (TC 3.A.5.1.1)
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q92MG5 at UniProt or InterPro
Protein Sequence (227 amino acids)
>SMc00717 ABC transporter ATP-binding protein (Sinorhizobium meliloti 1021) MTRDWAVPLIHFENVGLRYGMGPEILRDLTFDIPRRSFQFLTGPSGAGKTTLLRLLFLSL KPTRGLIRMFDRNISSIPREEFPMLRRRVGIVFQDFRLLDHLTTYENVALPLRVRGKEES SYRSDVLELLKWVGLGERLNVLPPVLSGGEKQRAAIARALIDRPEILLADEPTGNVDPPM ARRLLNLFMELNRLGTAVVIATHDLSLMDQVEARRMILSQGRLDIYE