Protein Info for SMc00717 in Sinorhizobium meliloti 1021

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 227 TIGR02673: cell division ATP-binding protein FtsE" amino acids 9 to 222 (214 residues), 279.9 bits, see alignment E=6.9e-88 PF00005: ABC_tran" amino acids 26 to 173 (148 residues), 108.1 bits, see alignment E=5.7e-35 PF13304: AAA_21" amino acids 110 to 209 (100 residues), 40.6 bits, see alignment E=3.1e-14

Best Hits

Swiss-Prot: 47% identical to FTSE_MYCTU: Cell division ATP-binding protein FtsE (ftsE) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K09812, cell division transport system ATP-binding protein (inferred from 98% identity to rhi:NGR_c27010)

Predicted SEED Role

"Cell division transporter, ATP-binding protein FtsE (TC 3.A.5.1.1)" in subsystem Bacterial Cell Division (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92MG5 at UniProt or InterPro

Protein Sequence (227 amino acids)

>SMc00717 ABC transporter ATP-binding protein (Sinorhizobium meliloti 1021)
MTRDWAVPLIHFENVGLRYGMGPEILRDLTFDIPRRSFQFLTGPSGAGKTTLLRLLFLSL
KPTRGLIRMFDRNISSIPREEFPMLRRRVGIVFQDFRLLDHLTTYENVALPLRVRGKEES
SYRSDVLELLKWVGLGERLNVLPPVLSGGEKQRAAIARALIDRPEILLADEPTGNVDPPM
ARRLLNLFMELNRLGTAVVIATHDLSLMDQVEARRMILSQGRLDIYE