Protein Info for SMc00711 in Sinorhizobium meliloti 1021

Annotation: cyclohexadienyl dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF07991: KARI_N" amino acids 6 to 95 (90 residues), 25.1 bits, see alignment E=3.1e-09 PF03446: NAD_binding_2" amino acids 7 to 130 (124 residues), 37.9 bits, see alignment E=4.6e-13 PF03807: F420_oxidored" amino acids 7 to 98 (92 residues), 36.1 bits, see alignment E=2.1e-12 PF02153: PDH_N" amino acids 20 to 172 (153 residues), 133.3 bits, see alignment E=1.3e-42 PF20463: PDH_C" amino acids 177 to 277 (101 residues), 102.9 bits, see alignment E=2.7e-33

Best Hits

Swiss-Prot: 44% identical to TYRC_ZYMMO: Cyclohexadienyl dehydrogenase (tyrC) from Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)

KEGG orthology group: K00220, cyclohexadieny/prephenate dehydrogenase [EC: 1.3.1.12 1.3.1.43] (inferred from 100% identity to sme:SMc00711)

Predicted SEED Role

"Cyclohexadienyl dehydrogenase (EC 1.3.1.12)(EC 1.3.1.43)" in subsystem Chorismate Synthesis or Phenylalanine and Tyrosine Branches from Chorismate (EC 1.3.1.12, EC 1.3.1.43)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.1.12 or 1.3.1.43

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92MG1 at UniProt or InterPro

Protein Sequence (307 amino acids)

>SMc00711 cyclohexadienyl dehydrogenase (Sinorhizobium meliloti 1021)
MAQQFQTIALIGIGLIGSSIARDIREKQLAGTIVVTTRSEATLKRAGELGLGDRYTLSAA
EAVEGADLVVVSVPVGASGAVAAEIAAHLKPGAIVTDVGSTKGSVIAQMAPHLPKDVHFV
PGHPIAGTEHSGPDAGFAGLFRGRWCILTPPAGTDEEAVARLRLFWETLGSMVDEMDPKH
HDKVLAIVSHLPHIIAYNIVGTADDLETVTESEVIKYSASGFRDFTRLAASDPTMWRDVC
LHNKDAILEMLARFSEDLASLQRAIRWGDGDKLFDLFTRTRAIRRSIVQAGQDTAMPDFG
RHAMDQK