Protein Info for SMc00710 in Sinorhizobium meliloti 1021

Annotation: histidinol-phosphate aminotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 368 TIGR01141: histidinol-phosphate transaminase" amino acids 12 to 363 (352 residues), 290 bits, see alignment E=1.1e-90 PF00155: Aminotran_1_2" amino acids 32 to 361 (330 residues), 186.7 bits, see alignment E=1.1e-58 PF01041: DegT_DnrJ_EryC1" amino acids 68 to 201 (134 residues), 36.6 bits, see alignment E=4.8e-13 PF00266: Aminotran_5" amino acids 69 to 195 (127 residues), 27.7 bits, see alignment E=2.1e-10

Best Hits

Swiss-Prot: 100% identical to HIS81_RHIME: Histidinol-phosphate aminotransferase 1 (hisC1) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00817, histidinol-phosphate aminotransferase [EC: 2.6.1.9] (inferred from 100% identity to smk:Sinme_2717)

Predicted SEED Role

"Biosynthetic Aromatic amino acid aminotransferase beta (EC 2.6.1.57)" in subsystem Phenylalanine and Tyrosine Branches from Chorismate (EC 2.6.1.57)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.57, 2.6.1.9

Use Curated BLAST to search for 2.6.1.57 or 2.6.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92MG0 at UniProt or InterPro

Protein Sequence (368 amino acids)

>SMc00710 histidinol-phosphate aminotransferase (Sinorhizobium meliloti 1021)
MNLALKSPAPRSGILDIAAYVPGKEHAPGVAKVHKLSSNETPLGASPRAIEAFQKAAFNL
ERYPDGQANALKEAIAAVHGLNPANILCGNGSDELLGLLCHTYLGPGDEGIVTEHGFLVY
KIQITASGGTPVTVKERQERVDVDAILAAVTERTKIVFIANPANPTGTYIPVEEVRRLHA
GLPAGVLLVLDAAYAEYVRRNDYEAGLELVSSNRNVVMTRTFSKIYGLAGLRIGWMYAPR
DVVEALDRVRGPFNLNAAAIAAGAAAIRDQAFVAAAVDQNHTWLAKIGQALTDIGLRVTP
SVTNFVLIHFPEEAGMSASDADAYLTSRGFILRAVGAYGFPNALRMTIGSEEANKGVVAA
LTEFMGRK