Protein Info for SMc00697 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 434 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 69 to 94 (26 residues), see Phobius details amino acids 99 to 118 (20 residues), see Phobius details amino acids 130 to 152 (23 residues), see Phobius details PF01595: CNNM" amino acids 19 to 193 (175 residues), 158.6 bits, see alignment E=2.1e-50 PF00571: CBS" amino acids 212 to 270 (59 residues), 24.6 bits, see alignment E=3.8e-09 amino acids 287 to 335 (49 residues), 32.4 bits, see alignment 1.4e-11 PF03471: CorC_HlyC" amino acids 351 to 425 (75 residues), 72.9 bits, see alignment E=2.7e-24

Best Hits

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_2731)

Predicted SEED Role

"Co2 transporter containing CBS domains"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92ME8 at UniProt or InterPro

Protein Sequence (434 amino acids)

>SMc00697 hypothetical protein (Sinorhizobium meliloti 1021)
MTDVLLGFLTEYWLSLLSVICLLVISAFFSGSETALTAASRSRMHTLENNGEERAGMVTR
LIERRDRLIGTLLIGNNLVNILASSLTTSLLIGLFGDSGVAIATVAMTVLLVIFSEVLPK
SWAIASPDRFALAVAPWVRPFVAVVGPISSLVNAIVRRILHLFGINLSSDLPMLTAHEEL
RGAVNLLHREGSVIKADRDRLGGVLDLGELEVSDVMIHRTGMRAINADDPPQTCVREILE
SPFTRLPLWRGSADNIIGVVHSKDLLRALAEPNVEPETLDIVKIAQKPWFVPDSTNLKDQ
LNAFLRRKLHLAIVVDEYGQVQGLVTLEDILEEIVGDIADEHDIDIQGVRQEADGSIVVD
GSVPIRDLNRALDWSLPDEEATTVAGLVIHESKSIPEERQAFTFYGKRFTVMKRVKNRIT
KLRIRAAEDEGQVG