Protein Info for SMc00652 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 221 PF10090: HPTransfase" amino acids 84 to 205 (122 residues), 124.5 bits, see alignment E=1.1e-40

Best Hits

Swiss-Prot: 62% identical to CHPT_BRUA2: Protein phosphotransferase ChpT (chpT) from Brucella abortus (strain 2308)

KEGG orthology group: K13588, histidine phosphotransferase ChpT (inferred from 100% identity to smk:Sinme_2775)

Predicted SEED Role

"Signal transduction histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92MB0 at UniProt or InterPro

Protein Sequence (221 amino acids)

>SMc00652 hypothetical protein (Sinorhizobium meliloti 1021)
MMAKNPNLTLTGHDLAALLCSRVCHDIISPVGAINNGLELLDEGGADADAMDLIRTSALN
ASVRLKFARLAFGASGSVGASIDTGEAEKAAKDFAASEKKTEVNWNGPRAIIAKNRVKLL
LNLFLIAYGSIPRGGVIDITLENPEFDAIFTLNAKGRMMRVPPKLVELISGTPEEAVDAH
SIQPYYTVLLAEEAGMAIDVVSTGEAIVFTARVVAPETVSA