Protein Info for SMc00647 in Sinorhizobium meliloti 1021

Annotation: ribosomal large subunit pseudouridine synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 343 TIGR00005: pseudouridine synthase, RluA family" amino acids 23 to 339 (317 residues), 298.4 bits, see alignment E=2.9e-93 PF01479: S4" amino acids 24 to 69 (46 residues), 34.8 bits, see alignment 1.1e-12 PF00849: PseudoU_synth_2" amino acids 98 to 267 (170 residues), 114.5 bits, see alignment E=5.4e-37

Best Hits

KEGG orthology group: K06180, ribosomal large subunit pseudouridine synthase D [EC: 5.4.99.12] (inferred from 100% identity to sme:SMc00647)

Predicted SEED Role

"Ribosomal large subunit pseudouridine synthase D (EC 4.2.1.70)" in subsystem Ribosome biogenesis bacterial (EC 4.2.1.70)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.70, 5.4.99.12

Use Curated BLAST to search for 4.2.1.70 or 5.4.99.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92MA7 at UniProt or InterPro

Protein Sequence (343 amino acids)

>SMc00647 ribosomal large subunit pseudouridine synthase (Sinorhizobium meliloti 1021)
MNDPFKQAPGNRKVLTAGDDAAGRLDAFLTEALAGEFSRNRIKSLIEQGAVSINGATVTE
PKRKVHPGDSFRIALPEPEDPEPKGEAIPLDVLYEDADLIVLVKPAGLVVHPGAGNWTGT
LVNALIHHCGDSLSGIGGVKRPGIVHRLDKDTSGVMVVAKNDAAHRHLSDQFADHGRNGP
LERAYRAVVWGRPRQLKGKIDAPLGRAGDRTKRAVKREDSDDAREAITHYEVVERYHEKP
DGTSLASTVECHLETGRTHQIRVHMAHIGHPLIGDPDYGAAFRTKANLLPEPARAAVNRF
PRQALHAFMLQFEHPATGETMHFETPVPADMQELIAALRAGAP