Protein Info for SMc00639 in Sinorhizobium meliloti 1021

Annotation: heat resistant agglutinin 1 signal peptide protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details PF13505: OMP_b-brl" amino acids 11 to 252 (242 residues), 46 bits, see alignment E=1e-15 PF02462: Opacity" amino acids 130 to 226 (97 residues), 24.7 bits, see alignment E=3.2e-09

Best Hits

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_2787)

Predicted SEED Role

"putative heat resistant agglutinin 1 signal peptide protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92MA1 at UniProt or InterPro

Protein Sequence (257 amino acids)

>SMc00639 heat resistant agglutinin 1 signal peptide protein (Sinorhizobium meliloti 1021)
MAFCAGLLAPFSAQAADEELLDAPEITISPEATGGGRLYLRGDIGYAAWLDEGDPFYRSF
GGTGEVSFDNARFDKPPSATIGLGYQFTDVIRADLTAEYFEGRFDGSSLSASPCAGEGAG
TRCALSHSANFSALGLMANGYLDLATLAGFTPYLGAGIGATRIDWKTTHETSTCVGAGGA
CSGAAGGASYGGRDSWRFTYALMAGVSYDVTDRLKFDAGYRYSQIADGDMFGSGGAKGHD
DGLSRHEFRVGLRFALW