Protein Info for SMc00615 in Sinorhizobium meliloti 1021

Annotation: phosphoribosylaminoimidazole synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00878: phosphoribosylformylglycinamidine cyclo-ligase
  • amino acids 9 to 339 (331 residues), 445.7 bits, E=5.1e-138
• PF00586: AIRS
  • amino acids 62 to 166 (105 residues), 82.7 bits, E=2.6e-27
• PF02769: AIRS_C
  • amino acids 180 to 343 (164 residues), 132.3 bits, E=1.8e-42

Best Hits

Swiss-Prot: 100% identical to PUR5_RHIME: Phosphoribosylformylglycinamidine cyclo-ligase (purM) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K01933, phosphoribosylformylglycinamidine cyclo-ligase [EC: 6.3.3.1] (inferred from 100% identity to smk:Sinme_0980)

Predicted SEED Role

"Phosphoribosylformylglycinamidine cyclo-ligase (EC 6.3.3.1)" in subsystem De Novo Purine Biosynthesis (EC 6.3.3.1)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (23/26 steps found)
• 5-aminoimidazole ribonucleotide biosynthesis I (5/5 steps found)
• superpathway of 5-aminoimidazole ribonucleotide biosynthesis (5/6 steps found)
• 5-aminoimidazole ribonucleotide biosynthesis II (4/5 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.3.1

Sequence Analysis Tools

See Q92QW2 at UniProt or InterPro

Protein Sequence (356 amino acids)

>SMc00615 phosphoribosylaminoimidazole synthetase (Sinorhizobium meliloti 1021)
MSQSGKNGLTYSDAGVDIDAGNLMVEKIKPHVRSTRRPGADGEIGGFGGLFDLKAAGFSD
PVLVAANDGVGTKLKIAIDADKHDTVGIDLVAMCVNDLVVQGAEPLFFLDYFATGKLDPD
QGAAIVAGIAAGCREAGCALIGGETAEMPGMYSGGDYDLAGFAVGAAERGQLLPAGDIAE
GDVILGLASSGVHSNGYSLVRKIVSLSGLAWDAPAPFGEGTLADLLMTPTRIYVKPLLKA
IRETGAIKALAHITGGGFPENIPRVLPKHLAAEIDLGAIKPPAVFSWLAKTGGVAANEML
RTFNCGVGMIAVVPASEAEKVAAVLAGEGETVFTLGRMVARAEGAPGTIYKGNLAI