Protein Info for SMc00610 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00052: nudix-type nucleoside diphosphatase, YffH/AdpP family
  • amino acids 10 to 189 (180 residues), 139.8 bits, E=3.9e-45
• PF00293: NUDIX
  • amino acids 48 to 168 (121 residues), 42.4 bits, E=3.5e-15

Best Hits

Swiss-Prot: 47% identical to NUDK_PECAS: GDP-mannose pyrophosphatase NudK (nudK) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_0976)

MetaCyc: 42% identical to GDP-mannose hydrolase (Escherichia coli K-12 substr. MG1655)
3.6.1.-

Predicted SEED Role

"Nudix hydrolase family protein YffH" in subsystem Nudix proteins (nucleoside triphosphate hydrolases)

Sequence Analysis Tools

See Q92QW5 at UniProt or InterPro

Protein Sequence (198 amino acids)

>SMc00610 hypothetical protein (Sinorhizobium meliloti 1021)
MTKNADARFRIIDRKTVWDGFINLEQITIEQEMSDGSTARLVREVHDHGRAATILLFDPE
RQVVVLVRQLRLPVFLQGETGYLLEAPAGLLDGEAPEVAICREAMEETGYRIETAMHLFD
AYMSPGSITERTSFFLGLIDISKKVAAGGGLAHEGEDIEVLEISFDEAVARIGTGEICDA
KTIMLLQWAMLNRASLAK