Protein Info for SMc00580 in Sinorhizobium meliloti 1021

Annotation: 4-hydroxythreonine-4-phosphate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 TIGR00557: 4-hydroxythreonine-4-phosphate dehydrogenase PdxA" amino acids 9 to 334 (326 residues), 416.7 bits, see alignment E=3.6e-129 PF04166: PdxA" amino acids 40 to 330 (291 residues), 346.2 bits, see alignment E=7.9e-108

Best Hits

Swiss-Prot: 100% identical to PDXA_RHIME: 4-hydroxythreonine-4-phosphate dehydrogenase (pdxA) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00097, 4-hydroxythreonine-4-phosphate dehydrogenase [EC: 1.1.1.262] (inferred from 99% identity to smk:Sinme_0947)

Predicted SEED Role

"4-hydroxythreonine-4-phosphate dehydrogenase (EC 1.1.1.262)" in subsystem Pyridoxin (Vitamin B6) Biosynthesis (EC 1.1.1.262)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.262

Use Curated BLAST to search for 1.1.1.262

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92QZ0 at UniProt or InterPro

Protein Sequence (342 amino acids)

>SMc00580 4-hydroxythreonine-4-phosphate dehydrogenase (Sinorhizobium meliloti 1021)
MSETSIGPVALTMGDPAGIGPDITLSVWAKRADRPTPPFLYVGDPALLAARAKLLGQTVP
ICETDCPGAVAAFRQALPVWPVRSPAPVIPGNPDAANASAVTDAIDTAVRLVLAGEASAL
ATNPISKAVLYEAGFRFPGHTEYLADLAARATGVAALPVMMLAGPKLRAVPVTIHIPLKD
VPAALTPDLIYETCTITAADLRSRFGLPAPRLAIAGLNPHAGEGGALGREDDAVIRPVID
RLRAEGLDVVGPLPADTMFHDRARETYDVAICMYHDQALIPAKALGFDDSVNVTLGLPFI
RTSPDHGTAFSLAGKGIAREESLLAALRLAAELARNAGGTKR