Protein Info for SMc00566 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 35 to 91 (57 residues), see Phobius details amino acids 118 to 138 (21 residues), see Phobius details amino acids 176 to 199 (24 residues), see Phobius details amino acids 224 to 266 (43 residues), see Phobius details amino acids 279 to 303 (25 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_0932)

Predicted SEED Role

"FIG003573: hypothetical protein" in subsystem CBSS-262719.3.peg.410

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92KG8 at UniProt or InterPro

Protein Sequence (317 amino acids)

>SMc00566 hypothetical protein (Sinorhizobium meliloti 1021)
MKTWNRTSLLTGVLAGITAALLSMGANTQSSLAIVLYAASALPILIAGLGWGNAAAIAAI
VVAGGAAVALVSPYFALLIVVVTLVPAGWLSHLSNLARPASELGGPEGSLAWYPLSDILV
HLAGLVTVGMVIVGYIVGYDSSVSDIMVDMVIEAVKAQEPLYNPDAAAIAQLKSIFTLAL
PLVQGAIWVLMLFAAYYLATRIVQLSGKALRPREDVPSSLRMHRNAIFVFLGGLALTFFG
GAPAVIGALVCGTFGAGFLLSGFASFHFRTRGKSWRLPVLWIAYLSVFVFTIPAFFFLLS
GLIDTRRAIALTPTGKN