Protein Info for SMc00564 in Sinorhizobium meliloti 1021

Annotation: transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 362 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details PF25917: BSH_RND" amino acids 57 to 252 (196 residues), 42.8 bits, see alignment E=5.7e-15 PF25876: HH_MFP_RND" amino acids 127 to 191 (65 residues), 31.6 bits, see alignment E=2.5e-11 PF25954: Beta-barrel_RND_2" amino acids 255 to 299 (45 residues), 25.3 bits, see alignment 2.1e-09

Best Hits

Swiss-Prot: 35% identical to EMRA_ACIBT: Colistin resistance protein EmrA (emrA) from Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_0930)

Predicted SEED Role

"Membrane fusion component of tripartite multidrug resistance system" in subsystem Multidrug Resistance, Tripartite Systems Found in Gram Negative Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92R00 at UniProt or InterPro

Protein Sequence (362 amino acids)

>SMc00564 transporter (Sinorhizobium meliloti 1021)
MNNEVVIMLKNFRSPTTLIVLLAGLAGLSLVLYAWRLPPFASSVETTENAYVRGYVTTIS
PQLSGYVAEVPVRDYEEVRAGQLLVRIDDRIYVQKLAQAKATLATQRSALANSFEQELSA
KAGIAASEAQLDGAKAALATARATWDRIRPLADKGVATRSDADQARAAFEQADAGVKQAI
ANLEVSRQSLATTLGARAGLEGSVAGAEAAVELAEIDLDNTRIVAPRAGRLGEIGARVGQ
YVTAGTQLLSVVPHEVWIVANFKETQLDGMRVGQPVTISVDALNRQVLRGHIERFSPAAG
SEFSIIRPDNATGNFTKVAQRLGVRIAVDPEQPMADRLAPGLSVVVRVDKAGEPQAAIAS
AG