Protein Info for SMc00558 in Sinorhizobium meliloti 1021

Annotation: transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 PF02311: AraC_binding" amino acids 31 to 163 (133 residues), 111.7 bits, see alignment E=3.3e-36 PF00165: HTH_AraC" amino acids 194 to 235 (42 residues), 31.9 bits, see alignment 1.8e-11 amino acids 250 to 283 (34 residues), 35.6 bits, see alignment 1.2e-12 PF12833: HTH_18" amino acids 207 to 284 (78 residues), 84.1 bits, see alignment E=1e-27

Best Hits

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_0924)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92R06 at UniProt or InterPro

Protein Sequence (285 amino acids)

>SMc00558 transcriptional regulator (Sinorhizobium meliloti 1021)
METISQEKAIEAMPLEGAERTRFWRDPRFKGMECLSATFITHEFAPHAHDTFSIGAIEAG
SQISTIKGERSQTGPGDLYLINPDEIHDGHPGHEGYRYRMVYPPTDLLVEILEDVTGRSF
KGTPSFSRLLLTDRELALGFHRAHRALEGKVGTLEADESMFGFLARLFERHGNAIIVPLQ
TRESSAVHRARDYLVENYTHDIGLEELAKLAGLSRAHLIRAFRKEFHITPHAFLTDKRVR
EAKALLRRGWSAADTAYHCGFADQAHFSRHFKARTGVTPGAYRSA