Protein Info for SMc00552 in Sinorhizobium meliloti 1021

Annotation: CDP-diacylglycerol--serine O-phosphatidyltransferase transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 transmembrane" amino acids 40 to 62 (23 residues), see Phobius details amino acids 68 to 86 (19 residues), see Phobius details amino acids 102 to 121 (20 residues), see Phobius details amino acids 127 to 145 (19 residues), see Phobius details amino acids 164 to 187 (24 residues), see Phobius details amino acids 193 to 215 (23 residues), see Phobius details amino acids 227 to 245 (19 residues), see Phobius details amino acids 250 to 268 (19 residues), see Phobius details PF01066: CDP-OH_P_transf" amino acids 41 to 193 (153 residues), 88.7 bits, see alignment E=5.4e-29 TIGR00473: CDP-diacylglycerol-serine O-phosphatidyltransferase" amino acids 47 to 212 (166 residues), 109.5 bits, see alignment E=8.3e-36 PF08009: CDP-OH_P_tran_2" amino acids 227 to 262 (36 residues), 37.2 bits, see alignment 2.2e-13

Best Hits

KEGG orthology group: K00998, phosphatidylserine synthase [EC: 2.7.8.8] (inferred from 100% identity to sme:SMc00552)

Predicted SEED Role

"CDP-diacylglycerol--serine O-phosphatidyltransferase (EC 2.7.8.8)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.8.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.8.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7APE0 at UniProt or InterPro

Protein Sequence (289 amino acids)

>SMc00552 CDP-diacylglycerol--serine O-phosphatidyltransferase transmembrane protein (Sinorhizobium meliloti 1021)
MEEPRHEQSAGIPEAAEHVGATGTHDKARGPRLREIPLRLMVPNMITVLAICAGLSGVRL
AFENRFELAVAMVLLAAFLDGIDGRIARLLKATSSFGVQMDSLADIINFGVAPALVLYVF
LLDQARSLGWIAALIYAIAVGLRLARFNVMAERQVKASWQSEYFVGVPAPAGAMLVLLPV
YLGLLGLAPERTFALIASVYTVLIAFLMVSRLPVWSGKSENRVRRDLVLPVILVVVFYVA
TLMTYTWETMVVTAVAYLVSLPFGARSWQRKYGDWPGGHGNDGLPGDSE