Protein Info for SMc00550 in Sinorhizobium meliloti 1021

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 627 transmembrane" amino acids 37 to 58 (22 residues), see Phobius details amino acids 74 to 92 (19 residues), see Phobius details amino acids 157 to 180 (24 residues), see Phobius details amino acids 186 to 204 (19 residues), see Phobius details amino acids 268 to 292 (25 residues), see Phobius details amino acids 303 to 324 (22 residues), see Phobius details PF00664: ABC_membrane" amino acids 40 to 313 (274 residues), 115.1 bits, see alignment E=4.9e-37 PF00005: ABC_tran" amino acids 379 to 528 (150 residues), 120.7 bits, see alignment E=7.3e-39

Best Hits

Swiss-Prot: 54% identical to ATM1_NOVAD: ATM1-type heavy metal exporter (atm1) from Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CIP 105152 / NBRC 16084 / F199)

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 100% identity to sme:SMc00550)

Predicted SEED Role

"ABC transporter HlyB/MsbA family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92R12 at UniProt or InterPro

Protein Sequence (627 amino acids)

>SMc00550 ABC transporter ATP-binding protein (Sinorhizobium meliloti 1021)
MAQKKTVSADSANPIETIANLWPYMWPADRIDLKLRVVWATVILVIAKAVLVLVPYFFKW
ATDALNNKPDALGFLPQFLTGAVMLVLAYNLARLLQAGLNQLRDALFASVGQHAVRQLAY
KTFVHMHQLSLRFHLERRTGGLSRIIERGTKGIETIVRFTILNSVPTLIEFLLTAVIFWW
GYGFTYLLVTAVTVWLYIWFTVRASDWRIAIRRSMNDSDTDANTKAIDSLLNFETVKYFG
NEEMEAKRFDKSMERYERAATQVWTSLGWLNFGQALIFGAGTAVMMTISALAVQRGEQTI
GDFVFINAMLIQLAIPLNFIGFVYREIRQGLTDIEHMFDLLDVRAEVVDRPNAKELKIER
GAIAFKNVQFAYDPARPILKGISFEVPAGKTVAVVGPSGAGKSTLSRLLYRFYDVQEGSI
TIDGQDVRDVTQKSLRSVIGMVPQDTVLFNDTIAYNIRYGRVTASDAEVEAAAEAAQIAD
FIRDLPEGFRAMVGERGLKLSGGEKQRVAIARTILKAPPILILDEATSALDTKTEQEIQA
ALDIVSRNRTTLVIAHRLSTVINADEIIVLKDGVIAERGTHGELIDRGGLYASMWSRQRE
ATQAEEQLKRVRESDDLGIVDRGMPAL