Protein Info for SMc00537 in Sinorhizobium meliloti 1021

Annotation: transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 412 transmembrane" amino acids 20 to 38 (19 residues), see Phobius details amino acids 58 to 76 (19 residues), see Phobius details amino acids 87 to 107 (21 residues), see Phobius details amino acids 111 to 132 (22 residues), see Phobius details amino acids 144 to 167 (24 residues), see Phobius details amino acids 173 to 194 (22 residues), see Phobius details amino acids 224 to 242 (19 residues), see Phobius details amino acids 249 to 276 (28 residues), see Phobius details amino acids 288 to 309 (22 residues), see Phobius details amino acids 317 to 337 (21 residues), see Phobius details amino acids 348 to 372 (25 residues), see Phobius details amino acids 380 to 399 (20 residues), see Phobius details TIGR00710: drug resistance transporter, Bcr/CflA subfamily" amino acids 18 to 396 (379 residues), 235.7 bits, see alignment E=5.9e-74 PF07690: MFS_1" amino acids 22 to 365 (344 residues), 126.1 bits, see alignment E=8.1e-41

Best Hits

KEGG orthology group: K07552, MFS transporter, DHA1 family, bicyclomycin/chloramphenicol resistance protein (inferred from 100% identity to smk:Sinme_1687)

Predicted SEED Role

"MFS family multidrug efflux protein, similarity to bicyclomycin resistance protein Bcr"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92PH4 at UniProt or InterPro

Protein Sequence (412 amino acids)

>SMc00537 transporter (Sinorhizobium meliloti 1021)
MTRPIDQAATISGLTKVQFIALMAMLMSINAISIDIMLPGLQEIGASLGVADENHRQYVI
TAYLLGMGFAQLFFGPLSDRFGRRAPLLGGLALYGVSALAIVFVPTFGALLFLRLVQGIG
AAATRVITVSIVRDVYGGRQMAEIMSLVMMVFMIVPVIAPSIGQLIMLFSEWHMIFVVIA
LFAVAVALPVALRLRETLAPANRRPFTASSILAGFRIVLTNRLALFYTLATSALLGALFG
FINSAQQILVGVYGLGVWFPAVFAAFAGMMAVASFTNSRLVRTFGMRALSHAALLGFTLA
SFIWMSASLIGPLPLPLFMLLHAATMFQFGLIAANFNAMAMEPLGHVAGTASSVLGFTQT
IGGGIIGAFIGQAFNNSVTPLAVGFFTVAVVALVCVLIAEGGKLFKPHNPAG