Protein Info for SMc00522 in Sinorhizobium meliloti 1021

Annotation: ATP-dependent RNA helicase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 499 PF00270: DEAD" amino acids 26 to 194 (169 residues), 162.7 bits, see alignment E=1e-51 PF04851: ResIII" amino acids 39 to 188 (150 residues), 36.6 bits, see alignment E=6.6e-13 PF00271: Helicase_C" amino acids 232 to 341 (110 residues), 109.8 bits, see alignment E=1.3e-35

Best Hits

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_1649)

Predicted SEED Role

"ATP-dependent RNA helicase Atu1833" in subsystem ATP-dependent RNA helicases, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92PK3 at UniProt or InterPro

Protein Sequence (499 amino acids)

>SMc00522 ATP-dependent RNA helicase (Sinorhizobium meliloti 1021)
MTNFADLGLSQKVLSAVTDAGYTIPTPIQVGAIPPALQRRDILGIAQTGTGKTASFVLPM
LTLLEKGRARARMPRTLILEPTRELAAQVAENFDKYGKNHKLNIALLIGGVSFDEQDRKL
ERGADVLICTPGRLLDHCERGKLLMTGVEILVIDEADRMLDMGFIPDIERIAKLIPFTRQ
TLFFSATMPPEIQKLADRFLQNPERLEVARRSSTAITVTQRFVAAHGKDYEKRAVLRELI
RSQEDLKNAIIFCNRKKDVAELFRSLDRHGFSVGALHGDMDQRSRMAMLANFKDGNIKLL
VASDVAARGLDIPDVSHVFNFDVPIHAEDYVHRIGRTGRAGRSGAAFTIVTKRETKFSDA
IEKLIGQKVEWFNGDLSELPEPMESHDSRRDRGSDGRKDRKRERPGKVHADRKPVTASGN
NTEELETVPERVDAVKIERNADSKDRHNGRSDRPGRAQNAANDDNRDRRQRNRRDHDDGP
TPVGFGDDIPAFMLIVGKA