Protein Info for SMc00511 in Sinorhizobium meliloti 1021
Annotation: D-ribulose-5-phosphate 3-epimerase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 54% identical to RPE_RHOCA: Ribulose-phosphate 3-epimerase (cbbE) from Rhodobacter capsulatus
KEGG orthology group: K01783, ribulose-phosphate 3-epimerase [EC: 5.1.3.1] (inferred from 100% identity to smk:Sinme_1660)MetaCyc: 52% identical to ribulose-phosphate 3-epimerase (Escherichia coli K-12 substr. MG1655)
Ribulose-phosphate 3-epimerase. [EC: 5.1.3.1]
Predicted SEED Role
"Ribulose-phosphate 3-epimerase (EC 5.1.3.1)" in subsystem Calvin-Benson cycle or Conserved gene cluster associated with Met-tRNA formyltransferase or Pentose phosphate pathway or Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization (EC 5.1.3.1)
MetaCyc Pathways
- photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (22/26 steps found)
- Bifidobacterium shunt (14/15 steps found)
- Rubisco shunt (10/10 steps found)
- superpathway of glucose and xylose degradation (15/17 steps found)
- Calvin-Benson-Bassham cycle (12/13 steps found)
- formaldehyde assimilation III (dihydroxyacetone cycle) (11/12 steps found)
- pentose phosphate pathway (8/8 steps found)
- 1-butanol autotrophic biosynthesis (engineered) (21/27 steps found)
- pentose phosphate pathway (non-oxidative branch) I (5/5 steps found)
- ethene biosynthesis V (engineered) (19/25 steps found)
- pentose phosphate pathway (partial) (3/3 steps found)
- oxygenic photosynthesis (13/17 steps found)
- pentose phosphate pathway (non-oxidative branch) II (5/6 steps found)
- formaldehyde assimilation II (assimilatory RuMP Cycle) (7/9 steps found)
- heterolactic fermentation (13/18 steps found)
KEGG Metabolic Maps
- Carbon fixation in photosynthetic organisms
- Pentose and glucuronate interconversions
- Pentose phosphate pathway
Isozymes
Compare fitness of predicted isozymes for: 5.1.3.1
Use Curated BLAST to search for 5.1.3.1
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q92PJ4 at UniProt or InterPro
Protein Sequence (226 amino acids)
>SMc00511 D-ribulose-5-phosphate 3-epimerase (Sinorhizobium meliloti 1021) MMTHPIRIAPSILAADFSKLGQEVRDVAEAGADWIHLDVMDGHFVPNITFGPDVIKSLRP HTRATFDCHLMIAPADPFLEAFAKAGCDIITVHAEAGPHLHRSLQTVKSLGKKAGVSINP ATPESAIEYVLDTVDLILVMTVNPGFGGQKFVGATEEKIRRIKAMIGSRPIEIEVDGGIA PDTAGVAAKAGANVLVAGSAIFKGDSVDAYRSAIEVLRTQAQKARG