Protein Info for SMc00476 in Sinorhizobium meliloti 1021

Annotation: transport transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 551 transmembrane" amino acids 26 to 48 (23 residues), see Phobius details amino acids 55 to 91 (37 residues), see Phobius details amino acids 97 to 116 (20 residues), see Phobius details amino acids 124 to 145 (22 residues), see Phobius details amino acids 168 to 193 (26 residues), see Phobius details amino acids 200 to 219 (20 residues), see Phobius details amino acids 251 to 273 (23 residues), see Phobius details amino acids 288 to 310 (23 residues), see Phobius details amino acids 330 to 361 (32 residues), see Phobius details amino acids 372 to 393 (22 residues), see Phobius details amino acids 398 to 415 (18 residues), see Phobius details amino acids 447 to 467 (21 residues), see Phobius details PF00916: Sulfate_transp" amino acids 22 to 386 (365 residues), 273.6 bits, see alignment E=2.3e-85 PF01740: STAS" amino acids 440 to 527 (88 residues), 64 bits, see alignment E=9.9e-22

Best Hits

KEGG orthology group: K03321, sulfate permease, SulP family (inferred from 100% identity to sme:SMc00476)

Predicted SEED Role

"Sulfate permease" in subsystem Cysteine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92PG2 at UniProt or InterPro

Protein Sequence (551 amino acids)

>SMc00476 transport transmembrane protein (Sinorhizobium meliloti 1021)
MPDSLVPKTVSILAEGYGAARLKADAFAGLTVAIVALPLSMAIAIASGVTPDRGLYTAIV
GGFLVSLLGGSRVQIGGPAGAFIVLVAATVARHGVDGLLLATLMSGFMLIAAGYLRLGRY
IKFIPYPVTVGFTAGIAVIIFASQLRDLFGLTLAGAEPGPIVDKVAALAQAAGTVSWAAV
LTAALTVGIILALRRVRPHWPGMLIAVAAASTFVALLQLPTETIGSRFGGIPRGLPLPAL
PPLSLEKAAAVFPDALSFALLGAIESLLSAVVADGMTGRRHRSSVELVAQGAANICSALF
GGICVTGTIARTATNVRAGATSPVSGILHSAFLLLFMLLAAPLASYIPLASLAGVLAIVA
WNMIEKPAFMALLRSSYGDAVVLLATFLIVVFRELTEGIVVGFALGAVLFIDRMARSISV
QEARPLSAQRQENGDERPVIADDPDTVIYRLSGIFFFGSAATVGTVLDRIADQRRNFILD
CSDVPFMDSTAANVIEGTLRKAERTGVRFIITGARSQVRRALYQHHVRPPRVMMRASVAA
ALDTIRTERVP