Protein Info for SMc00472 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04227: Indigoidine_A
  • amino acids 16 to 305 (290 residues), 423.8 bits, E=1.8e-131

Best Hits

Swiss-Prot: 83% identical to PSUG1_RHIL3: Pseudouridine-5'-phosphate glycosidase 1 (psuG1) from Rhizobium leguminosarum bv. viciae (strain 3841)

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_1706)

MetaCyc: 51% identical to pseudouridine-5'-phosphate glycosidase (Escherichia coli K-12 substr. MG1655)
Pseudouridylate synthase. [EC: 4.2.1.70]

Predicted SEED Role

"Indigoidine synthase A-like protein, uncharacterized enzyme involved in pigment biosynthesis"

MetaCyc Pathways

• pseudouridine degradation (1/2 steps found)

KEGG Metabolic Maps

• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.70

Use Curated BLAST to search for 4.2.1.70

Sequence Analysis Tools

See Q92PG0 at UniProt or InterPro

Protein Sequence (310 amino acids)

>SMc00472 hypothetical protein (Sinorhizobium meliloti 1021)
MTKPSSPSLPMEYSDEVAAAKQRGAPIVALESTIITHGMPYPGNLDMARSVEAIIREQGA
VPATIAVIHGVLHIGLDDAKLEALSKTQGAMKLSRADLAFAIAERRTGATTVAATMIAAA
RAGIRVFATGGIGGVHRGAEQSFDISADLDELARTGVIVVCAGAKAILDIPKTLEVLESR
GVPVVTYDSENFPAFWSRESGLKSPLMLNSPAAIASFQRTRELLGIDGGMLVANPVPVES
EIPREEMEIYITRALDNAASEGISGKAVTPYLLDNLFRLTDGRSLETNIALVENNARLAA
GIAVALAAND