Protein Info for SMc00461 in Sinorhizobium meliloti 1021

Annotation: deoxyuridine 5'-triphosphate nucleotidohydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00576: dUTP diphosphatase
  • amino acids 19 to 158 (140 residues), 172.5 bits, E=2.1e-55
• PF00692: dUTPase
  • amino acids 27 to 158 (132 residues), 99.6 bits, E=5.7e-33

Best Hits

Swiss-Prot: 100% identical to DUT_RHIME: Deoxyuridine 5'-triphosphate nucleotidohydrolase (dut) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K01520, dUTP pyrophosphatase [EC: 3.6.1.23] (inferred from 100% identity to smk:Sinme_3675)

Predicted SEED Role

"Deoxyuridine 5'-triphosphate nucleotidohydrolase (EC 3.6.1.23)" in subsystem Nudix proteins (nucleoside triphosphate hydrolases) (EC 3.6.1.23)

MetaCyc Pathways

• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (17/18 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis I (9/9 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (12/14 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis III (8/9 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis II (5/7 steps found)
• pyrimidine deoxyribonucleotides dephosphorylation (1/3 steps found)

KEGG Metabolic Maps

• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.23

Sequence Analysis Tools

See Q92SM6 at UniProt or InterPro

Protein Sequence (160 amino acids)

>SMc00461 deoxyuridine 5'-triphosphate nucleotidohydrolase (Sinorhizobium meliloti 1021)
MHTPENRPALTPGLTLVRLPHGEGLDLPAYETAGAAGMDLRAALPADEPMTIRPGERALV
PTGFIFEIPAGHEGQIRPRSGLAFKHGITCLNTPGTVDSDYRGEVKVLLVNLGAEDFAVE
RGMRIAQMVIAPVTRLAIREAGGATTTARGAGGFGSTGTK