Protein Info for SMc00455 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 220 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 51 to 72 (22 residues), see Phobius details amino acids 84 to 102 (19 residues), see Phobius details amino acids 108 to 131 (24 residues), see Phobius details amino acids 138 to 158 (21 residues), see Phobius details amino acids 164 to 185 (22 residues), see Phobius details amino acids 196 to 218 (23 residues), see Phobius details PF03006: HlyIII" amino acids 19 to 207 (189 residues), 92.6 bits, see alignment E=1.5e-30

Best Hits

KEGG orthology group: K11068, hemolysin III (inferred from 100% identity to smk:Sinme_0698)

Predicted SEED Role

"COG1272: Predicted membrane protein hemolysin III homolog"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92RA6 at UniProt or InterPro

Protein Sequence (220 amino acids)

>SMc00455 hypothetical protein (Sinorhizobium meliloti 1021)
MKVAGVKWDYDRSEMIADAIVHGIGLSAALVGVTALIFYATVWSTSGQLAAASIYGGGLI
AALSISFVYNLFPVGRAKWFLRRLDHSGIFVLIAATYTPFLQRGWDDPFLFSMLVAIWLI
AAAGIAMKCLLPGRFDRLAILLYLAMGWSGLLAAKSLFTALSATTLTLIVIGGVIYSVGV
IFHVWERLRFQNAIWHGFVVTGAAVHYSAVLTCISSAAVS