Protein Info for SMc00451 in Sinorhizobium meliloti 1021

Annotation: processing protease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 432 PF00675: Peptidase_M16" amino acids 14 to 160 (147 residues), 165.7 bits, see alignment E=7.2e-53 PF05193: Peptidase_M16_C" amino acids 166 to 339 (174 residues), 126.7 bits, see alignment E=9.5e-41

Best Hits

KEGG orthology group: K01422, [EC: 3.4.99.-] (inferred from 100% identity to sme:SMc00451)

Predicted SEED Role

"Mitochondrial processing peptidase-like protein (EC 3.4.24.64)" in subsystem ZZ gjo need homes (EC 3.4.24.64)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.24.64 or 3.4.99.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92RF6 at UniProt or InterPro

Protein Sequence (432 amino acids)

>SMc00451 processing protease (Sinorhizobium meliloti 1021)
MKVECTRLPSGLTVVTERMPHLESVALGVWIKSGSRNETVNEHGIAHLLEHMAFKGTRRR
SARQIAEEIENVGGEVNAATSTETTSYYARVLKDHLPLAVDILADILTESTFEADELRRE
KQVILQEIGAADDTPDDVVFDRFAETAYRGQTVGRPILGTPETVMSFSADQIRQYLGRNY
TTDRTFIVAAGAVDHDTIVRQVEERFASLPAEPVCAPVIETARYTGGDSRESRDLMDAQV
LLGFEGKAYHARDFYCSQILANILGGGMSSRLFQEVREHRGLCYSVYAFHWGFSDTGIFG
VHAATGGENLPELMPVIVDELRKSSLSIDQQEIERARAQIRAQLLMGQESPAARAGQIAR
QMMLYGRPIPNEELMERLSGITIERLTDLAGRLFFDTVPTLSAIGPLGQLAPLNDILSSL
TTKADAIHAAAS