Protein Info for SMc00410 in Sinorhizobium meliloti 1021

Annotation: oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 242 to 263 (22 residues), see Phobius details PF04321: RmlD_sub_bind" amino acids 10 to 210 (201 residues), 40.7 bits, see alignment E=4.7e-14 PF01370: Epimerase" amino acids 10 to 207 (198 residues), 61.7 bits, see alignment E=2.1e-20 PF05368: NmrA" amino acids 10 to 86 (77 residues), 35.9 bits, see alignment E=1.7e-12 PF01073: 3Beta_HSD" amino acids 12 to 114 (103 residues), 30 bits, see alignment E=8.6e-11 PF13460: NAD_binding_10" amino acids 14 to 157 (144 residues), 49.9 bits, see alignment E=1.1e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_3660)

Predicted SEED Role

"NADH-UBIQUINONE OXIDOREDUCTASE 39 KD SUBUNIT (EC 1.6.5.3)" (EC 1.6.5.3)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92SP0 at UniProt or InterPro

Protein Sequence (326 amino acids)

>SMc00410 oxidoreductase (Sinorhizobium meliloti 1021)
MTLSNLPPLVTIFGGSGFVGRHVVRALAKRGYRIRVAVRRPDLAGHLQPLGNVGQISFVQ
ANLRYRRSVDRAVDGADHVINCVGVLFESGRNTFEAVQDFGARAVAEAARATGATLTHIS
AIGADANSESSYARTKGRAEAAILETLPAAVILRPSIIFGPEDGFFNKFAEMARFSPVLP
LIGGGNTRFQPVYVTDVAEAVARSVDGTLTGGTIYELGGPQVLSFRECLDIMLKTIDRKR
SFVSLPFGIASLMGSVASLVPFITPPLTADQVVLLKLDNVVSAKAEAEGRTLAGIGIEPT
MLESILPTYLVRYRPHGQYTRSGRAA