Protein Info for SMc00406 in Sinorhizobium meliloti 1021

Annotation: 4Fe-4S ferredoxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 366 TIGR00276: epoxyqueuosine reductase" amino acids 22 to 354 (333 residues), 444.6 bits, see alignment E=1e-137 PF08331: QueG_DUF1730" amino acids 71 to 147 (77 residues), 82.5 bits, see alignment E=1.6e-27 PF13484: Fer4_16" amino acids 199 to 263 (65 residues), 79.3 bits, see alignment E=3e-26

Best Hits

Swiss-Prot: 59% identical to QUEG_ROSLO: Epoxyqueuosine reductase (queG) from Roseobacter litoralis (strain ATCC 49566 / DSM 6996 / JCM 21268 / NBRC 15278 / OCh 149)

KEGG orthology group: None (inferred from 100% identity to sme:SMc00406)

Predicted SEED Role

"Iron-sulfur cluster-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92SP4 at UniProt or InterPro

Protein Sequence (366 amino acids)

>SMc00406 4Fe-4S ferredoxin (Sinorhizobium meliloti 1021)
MPGDAAKADNQGRKRRTLTAFLKEEAAAKGFDICRITHPDAIPQAPERLRQFLAAGAHGT
MDWLAETAERRSDPRVLWSEVRSIVLFGMNYAPEDDPREVLARRDRGAISVYARNRDYHD
VVKGRLKEIATRFAARAGEDVKVFVDTAPVMEKPLAEKAGIGWQGKHTNLVSREFGSWLF
LGSLFTTAELDLDEPERDHCGSCRACLDACPTDAFPAPYRIDARRCISYLTIEHKGSIAP
ELRPLIGNRIYGCDDCLAACPWNKFARSASEMKLQARDDLREPELSFLLTLDDPGFRAFF
SGSPVKRIGRDRFVRNALIAAGNSGEKSLIEVCKALAADASPTVRGMAVWALSRLISSAD
LAVFAR