Protein Info for SMc00352 in Sinorhizobium meliloti 1021

Annotation: acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 175 PF00583: Acetyltransf_1" amino acids 51 to 146 (96 residues), 48.7 bits, see alignment E=2.2e-16 PF13673: Acetyltransf_10" amino acids 58 to 149 (92 residues), 38.5 bits, see alignment E=2.7e-13 PF13508: Acetyltransf_7" amino acids 64 to 147 (84 residues), 43.3 bits, see alignment E=1e-14 PF08445: FR47" amino acids 94 to 148 (55 residues), 23.7 bits, see alignment E=1e-08

Best Hits

Swiss-Prot: 40% identical to TTR_PSEAJ: Acetyltransferase (ttr) from Pseudomonas amygdali pv. tabaci

KEGG orthology group: None (inferred from 100% identity to sme:SMc00352)

MetaCyc: 40% identical to tabtoxinine-beta-lactam acetyltransferase (Pseudomonas syringae)
2.3.1.-

Predicted SEED Role

No annotation

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92SU0 at UniProt or InterPro

Protein Sequence (175 amino acids)

>SMc00352 acetyltransferase (Sinorhizobium meliloti 1021)
MPDVDIRVLTAGDTLAALPALAEILSDCVEGGASVGFMQPFSPNDAVHFWEGVAAAVGRS
ETVLLAAEVDGRMVGTVQLGVSTMPNQPHRADVRKLLVHRDARGLGLSRRLMDAAEAEAV
RRGRRVLVLDTATGEPAEAIYERFGWTRAGIVPDYALMPDGRYCATTFFYKHLAT