Protein Info for SMc00351 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 197 PF13560: HTH_31" amino acids 17 to 71 (55 residues), 53.2 bits, see alignment E=7.5e-18 PF12844: HTH_19" amino acids 20 to 78 (59 residues), 35.2 bits, see alignment E=2.7e-12 PF13443: HTH_26" amino acids 20 to 75 (56 residues), 34.4 bits, see alignment E=5.5e-12 PF01381: HTH_3" amino acids 21 to 74 (54 residues), 57.6 bits, see alignment E=2.5e-19 PF07883: Cupin_2" amino acids 120 to 191 (72 residues), 27.2 bits, see alignment E=6.4e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to sme:SMc00351)

Predicted SEED Role

"Transcriptional regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92SU1 at UniProt or InterPro

Protein Sequence (197 amino acids)

>SMc00351 hypothetical protein (Sinorhizobium meliloti 1021)
MQSPIMENAIAPLEETMAMRLRELRMARDLTLDDLAGRSGVSRAMISRIERGEASPTAQL
LAKLCSALGTTLSALFASERSEASPLARHAEQRLWRDPESGYLRRSVSPEGVGSPVDIVE
VEFPPGARVVFERQPMDRGITQHLWLFSGRLELTMESGRQLLEPGDCLFMGLEEAHIFHN
PHEEPAHYAVILCRNKV