Protein Info for SMc00350 in Sinorhizobium meliloti 1021

Annotation: transport transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 421 signal peptide" amino acids 7 to 11 (5 residues), see Phobius details transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 45 to 67 (23 residues), see Phobius details amino acids 76 to 99 (24 residues), see Phobius details amino acids 105 to 122 (18 residues), see Phobius details amino acids 134 to 156 (23 residues), see Phobius details amino acids 162 to 182 (21 residues), see Phobius details amino acids 202 to 226 (25 residues), see Phobius details amino acids 238 to 256 (19 residues), see Phobius details amino acids 267 to 286 (20 residues), see Phobius details amino acids 292 to 312 (21 residues), see Phobius details amino acids 325 to 347 (23 residues), see Phobius details amino acids 359 to 377 (19 residues), see Phobius details PF07690: MFS_1" amino acids 42 to 193 (152 residues), 38.3 bits, see alignment E=7.7e-14 amino acids 206 to 383 (178 residues), 57.3 bits, see alignment E=1.3e-19 PF00083: Sugar_tr" amino acids 45 to 153 (109 residues), 22.6 bits, see alignment E=4.7e-09

Best Hits

KEGG orthology group: None (inferred from 100% identity to sme:SMc00350)

Predicted SEED Role

"FIG01075110: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92SU2 at UniProt or InterPro

Protein Sequence (421 amino acids)

>SMc00350 transport transmembrane protein (Sinorhizobium meliloti 1021)
MHRSPSSLLSIASIVASMTSVAVGNGMMLAYVPFVLTRSAAPDWVPGAAVTAIAFGGLIG
CLMGGSLIRRVGHARAFSCSMALVILAALMISLGVHPLLWVVARGLYGIAANMNFIITQS
WLNHASENHWRGRAMALFYMAYVIGLGAGAWLFGQIPVEGNLAPIVTIFFTAVAILPIGL
TRLPTPPAPARVSIDIPMVWRISPVAFIGVLASGGLSMLVQGFTPIYAAANSVSQKEVAA
LMFVMQFGLLFIQYPMGALSDRTDRRIVLIATCTLVIAAGIAALAVSFDNLLLLMLVFAM
FAGAVETVYSIANAHANDRTDPADFVPLASTMLVAWSASATLVPMLVTLLTPAFGQRTFI
YATMTVALLYALFVLVRLRSRERVPPELCDSFEFKSAQVPNAVALAETEARAERPVRRPD
L