Protein Info for SMc00328 in Sinorhizobium meliloti 1021

Annotation: 3-hydroxydecanoyl-ACP dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 171 TIGR01749: beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabA" amino acids 4 to 169 (166 residues), 301.3 bits, see alignment E=9.6e-95 PF07977: FabA" amino acids 29 to 158 (130 residues), 157.1 bits, see alignment E=2.1e-50 PF22818: ApeI-like" amino acids 53 to 124 (72 residues), 36 bits, see alignment E=5.9e-13

Best Hits

Swiss-Prot: 100% identical to FABA_RHIME: 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase (fabA) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K01716, 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase [EC: 4.2.1.60] (inferred from 100% identity to sme:SMc00328)

MetaCyc: 79% identical to 3-hydroxy-acyl-[acyl-carrier-protein] dehydratase (Agrobacterium fabrum C58)
Trans-2-decenoyl-[acyl-carrier-protein] isomerase. [EC: 5.3.3.14]; 3-hydroxyoctanoyl-[acyl-carrier-protein] dehydratase. [EC: 5.3.3.14, 4.2.1.59]

Predicted SEED Role

"3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase (EC 4.2.1.59)" (EC 4.2.1.59)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.59

Use Curated BLAST to search for 4.2.1.59 or 4.2.1.60 or 5.3.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92SV8 at UniProt or InterPro

Protein Sequence (171 amino acids)

>SMc00328 3-hydroxydecanoyl-ACP dehydratase (Sinorhizobium meliloti 1021)
MNTRQSSFSYEEILICGRGEMFGPGNAQLPLPPMLMFNRITDISETGGPNDKGYVRAEFD
ITPDLWFFPCHFMGDPVMPGCLGLDAMWQLTGFFLGWLGEAGKGRAISTGEVKFTGMVTP
KTKLVEYGIDFKRVMRGRLVLGIADGWMKADGETIYKATDLRVGLFQEKAD