Protein Info for SMc00317 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 32 to 53 (22 residues), see Phobius details amino acids 65 to 87 (23 residues), see Phobius details amino acids 107 to 119 (13 residues), see Phobius details amino acids 123 to 146 (24 residues), see Phobius details amino acids 167 to 187 (21 residues), see Phobius details amino acids 199 to 218 (20 residues), see Phobius details amino acids 230 to 250 (21 residues), see Phobius details amino acids 256 to 277 (22 residues), see Phobius details amino acids 289 to 309 (21 residues), see Phobius details PF03547: Mem_trans" amino acids 5 to 304 (300 residues), 85.2 bits, see alignment E=1.8e-28

Best Hits

Swiss-Prot: 100% identical to MDCF_RHIME: Putative malonate transporter (mdcF) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K07088, (no description) (inferred from 100% identity to smk:Sinme_1578)

Predicted SEED Role

"Transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P56949 at UniProt or InterPro

Protein Sequence (320 amino acids)

>SMc00317 hypothetical protein (Sinorhizobium meliloti 1021)
MAEITGLVLPFFGLIFLGYLTARLVDHPGEAMGWLNTFIVYLALPALFFKLVSRTPVEEL
TRADFILTSVGTTYVVFALIFAIGLFLRRNTVAEATMQGFAGAYGNIGYMGPGLALLALG
ETAAVPVALIFCFENAAHFTVAPAMMAAAGGSKQKPAVVALGIARRIAFHPFILSTFAGV
AAAFLSFEPPLPLQRLIDYLAQAAAPCALFAMGVTLALRPLKRIPAEIGYIVPAKLVLHP
VLMYLALSLGGAYDPIWVQTAVLLASLPTATNVFVIGQQYGVWQERASATILITTLLSVA
TVTGLLYLIRSGALPADLFP