Protein Info for SMc00286 in Sinorhizobium meliloti 1021

Annotation: hemolysin-type calcium-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 PF00353: HemolysinCabind" amino acids 106 to 116 (11 residues), 10.6 bits, see alignment (E = 2.5e-05) amino acids 127 to 160 (34 residues), 15.5 bits, see alignment 7.2e-07 amino acids 198 to 231 (34 residues), 23.1 bits, see alignment 3e-09 amino acids 206 to 240 (35 residues), 27 bits, see alignment 1.7e-10 amino acids 215 to 249 (35 residues), 33.2 bits, see alignment 2e-12 amino acids 241 to 269 (29 residues), 22.3 bits, see alignment (E = 5.2e-09)

Best Hits

KEGG orthology group: None (inferred from 100% identity to sme:SMc00286)

Predicted SEED Role

"possible protease( EC:3.4.24.40 )"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92KB8 at UniProt or InterPro

Protein Sequence (363 amino acids)

>SMc00286 hemolysin-type calcium-binding protein (Sinorhizobium meliloti 1021)
MLIDDQPEISMVLPKGRAMATRIYGTNYADIIKQNGYIAIEIYAYDGDDDIYLNRTDSYG
GYNFVDAGYGNDLVVNSYEGGNDIYLGGGNDIYVADIRVRDASSYDIVYGGSGNDRFEIE
GYASDYYGESGNDTFFSVGFNNYFNGGTGTDTISYQFQDDWSAERGKGVTIDLGYNYATT
GSGRREDLISIENATGTNYGHDDITGSAVANTLRGLGGHDIIEGLGGNDVLDGGSGDDDL
YGGSGADILRGGTGFDYLVGGTGTDSFDFNSISESAVGSRRDVITDFHRSEFDVIDLSTI
DADTTWSGNQSFTYIGGNAFSGEAGELNFRSGIISGDVNGDGYADFQVRVNGATSLRVDD
FFL