Protein Info for SMc00271 in Sinorhizobium meliloti 1021

Annotation: periplasmic binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF03480: DctP" amino acids 26 to 304 (279 residues), 287.8 bits, see alignment E=4.7e-90 TIGR00787: TRAP transporter solute receptor, DctP family" amino acids 26 to 279 (254 residues), 288.3 bits, see alignment E=2.7e-90

Best Hits

Swiss-Prot: 38% identical to DCTP_VEREI: Solute-binding protein Veis_3954 (Veis_3954) from Verminephrobacter eiseniae (strain EF01-2)

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_1605)

MetaCyc: 34% identical to 2,3-diketo-L-gulonate:Na+ symporter - periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-235

Predicted SEED Role

"TRAP-type C4-dicarboxylate transport system, periplasmic component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92PN7 at UniProt or InterPro

Protein Sequence (325 amino acids)

>SMc00271 periplasmic binding protein (Sinorhizobium meliloti 1021)
MNLRHLLTAAVLSLCAGPAAAQTYQLSHNAAAGNPKDVASLKFAELVEQKSEGRLKIDVG
GSAQFGDDAETITNMRLGTIAFSANSQGTTSAVVPEIALLGLPFLFQDLKQAEAVMDGPV
GDKIAAAAEQQGLVVLAWWNNGIRETSNSKRQITAPSDLAGMKIRTPPDQMTVDIFTALG
ASPTPMAFSELYIALQQGVVDGQENPLINIHSSKLHEVQPYISMTNHKYESTPFLASKIV
FDALLPEDQQIIRDAAREAGQLNRQMVGEQTTRLRGELEAAGVKINDVDPAPFVQATQSV
YDKWRAQYPDLVDELVGAAKAAAVQ