Protein Info for SMc00270 in Sinorhizobium meliloti 1021
Annotation: transketolase subunit alpha
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 73% identical to Y4MO_SINFN: Putative uncharacterized transketolase family protein y4mO (NGR_a02440) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)
KEGG orthology group: K00615, transketolase [EC: 2.2.1.1] (inferred from 100% identity to sme:SMc00270)Predicted SEED Role
"Transketolase, N-terminal section (EC 2.2.1.1)" in subsystem Calvin-Benson cycle or Pentose phosphate pathway (EC 2.2.1.1)
MetaCyc Pathways
- photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (22/26 steps found)
- Bifidobacterium shunt (14/15 steps found)
- Rubisco shunt (10/10 steps found)
- superpathway of glucose and xylose degradation (15/17 steps found)
- Calvin-Benson-Bassham cycle (12/13 steps found)
- formaldehyde assimilation III (dihydroxyacetone cycle) (11/12 steps found)
- pentose phosphate pathway (8/8 steps found)
- 1-butanol autotrophic biosynthesis (engineered) (21/27 steps found)
- pentose phosphate pathway (non-oxidative branch) I (5/5 steps found)
- ethene biosynthesis V (engineered) (19/25 steps found)
- pentose phosphate pathway (partial) (3/3 steps found)
- oxygenic photosynthesis (13/17 steps found)
- pentose phosphate pathway (non-oxidative branch) II (5/6 steps found)
- formaldehyde assimilation II (assimilatory RuMP Cycle) (7/9 steps found)
KEGG Metabolic Maps
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of ansamycins
- Biosynthesis of phenylpropanoids
- Biosynthesis of plant hormones
- Carbon fixation in photosynthetic organisms
- Pentose phosphate pathway
Isozymes
Compare fitness of predicted isozymes for: 2.2.1.1
Use Curated BLAST to search for 2.2.1.1
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q92PN8 at UniProt or InterPro
Protein Sequence (284 amino acids)
>SMc00270 transketolase subunit alpha (Sinorhizobium meliloti 1021) MTSQSPAVQLSNTSLARRAWEIRRKAVRMGEVQGQGYVGQALGIADVLAVSYFHALTYRR QDPEWEGRDRFLLSIGHYAIALYAALIEAGILPEQELETYGTDDSRLPMSGMAAYTPGME ITGGSLGQGLGIGVGMALGLKAKKNPAFVYNLMSDGELGEGSTWEAAMSAAHHKLGNLIC LVDFNDQQADGKSTEMLCSEPLGAKWAAFGWHVQRVDGNDIPALVAAFDAARALEEAMPR VIICDTLMCKGVPFLEQREVTHFVRVDADEWQKALAALDANRPD