Protein Info for SMc00247 in Sinorhizobium meliloti 1021

Annotation: phosphatidylcholine synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 241 signal peptide" amino acids 16 to 19 (4 residues), see Phobius details transmembrane" amino acids 20 to 38 (19 residues), see Phobius details amino acids 45 to 63 (19 residues), see Phobius details amino acids 83 to 101 (19 residues), see Phobius details amino acids 107 to 124 (18 residues), see Phobius details amino acids 133 to 152 (20 residues), see Phobius details amino acids 158 to 177 (20 residues), see Phobius details amino acids 188 to 207 (20 residues), see Phobius details amino acids 213 to 235 (23 residues), see Phobius details PF01066: CDP-OH_P_transf" amino acids 21 to 171 (151 residues), 25 bits, see alignment E=1.1e-09

Best Hits

Swiss-Prot: 100% identical to PCS_RHIME: Phosphatidylcholine synthase (pcs) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K01004, phosphatidylcholine synthase [EC: 2.7.8.24] (inferred from 100% identity to smk:Sinme_1576)

MetaCyc: 100% identical to phosphatidylcholine synthase (Sinorhizobium meliloti 1021)
Phosphatidylcholine synthase. [EC: 2.7.8.24]

Predicted SEED Role

"Phosphatidylcholine synthase (EC 2.7.8.24)" in subsystem ZZ gjo need homes (EC 2.7.8.24)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.8.24

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q9KJY8 at UniProt or InterPro

Protein Sequence (241 amino acids)

>SMc00247 phosphatidylcholine synthase (Sinorhizobium meliloti 1021)
MKFFNYRRVPYAEIRAFSVHILTASGSFLAFLGVVAAAEHRFVDMFWWLGLALLVDGIDG
PIARKVQVKEVLPNWSGDTLDNVIDYVTYVLLPAFALYQSGMIGEPWSFVAAGAIVVSSA
IYYADMGMKTDEYFFSGFPVVWNMVVFTLFVIQASEVTASIVVFLSVILTFLPINFLHPV
RVKRLRPLNLGIFLVWSVLGMYALLLHFETPPWVVVGVVATGLYLYVIGFILQIFPKLGR
A