Protein Info for SMc00232 in Sinorhizobium meliloti 1021

Annotation: bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 456 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF01128: IspD" amino acids 6 to 117 (112 residues), 31.5 bits, see alignment E=4.6e-11 PF00483: NTP_transferase" amino acids 7 to 149 (143 residues), 50 bits, see alignment E=9.1e-17 PF02348: CTP_transf_3" amino acids 7 to 137 (131 residues), 28.4 bits, see alignment E=4.3e-10 PF12804: NTP_transf_3" amino acids 7 to 141 (135 residues), 77.8 bits, see alignment E=3.4e-25 TIGR01173: UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase" amino acids 7 to 432 (426 residues), 466 bits, see alignment E=6.8e-144 PF14602: Hexapep_2" amino acids 380 to 413 (34 residues), 37.9 bits, see alignment 3.6e-13 PF00132: Hexapep" amino acids 380 to 413 (34 residues), 32.2 bits, see alignment 1.9e-11

Best Hits

Swiss-Prot: 100% identical to GLMU_RHIME: Bifunctional protein GlmU (glmU) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K04042, bifunctional UDP-N-acetylglucosamine pyrophosphorylase / Glucosamine-1-phosphate N-acetyltransferase [EC: 2.3.1.157 2.7.7.23] (inferred from 100% identity to sme:SMc00232)

Predicted SEED Role

"N-acetylglucosamine-1-phosphate uridyltransferase (EC 2.7.7.23) / Glucosamine-1-phosphate N-acetyltransferase (EC 2.3.1.157)" in subsystem Peptidoglycan Biosynthesis or Sialic Acid Metabolism or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 2.3.1.157, EC 2.7.7.23)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.157 or 2.7.7.23

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92PS3 at UniProt or InterPro

Protein Sequence (456 amino acids)

>SMc00232 bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase (Sinorhizobium meliloti 1021)
MERTCLAIILAAGESTRMKSAMSKVLHPVAGRPMIAHVVDALASASISDVALVVGRDADA
VSAAAATDEVAVTSFLQKERLGTAHAVLAAREAIAKGYDDVLVVFGDTPLITAAPLKAAR
DGLAAGNDVVVIGFQATDPTGYGRLIVKDGALVAIREHRDASDEERRITYCNGGLMAIDG
RKALDLLNRIGNANAKGEYYLTDLVEIARSLDGRAIAVEAPEEELTGCNTRAELAYIERL
WQQRRRHELMLAGVSMIAPETVFLSWDTALAQDVLLEPNVVFGPGVRVESGAVIHAFSHL
EGAHVRAGATVGPFARLRPGADLGAKSKVGNFCEVKNAEIGAGAKVNHLTYIGDAFVGAG
SNIGAGTITCNYDGVNKHVTRIGANAFVGSNSSLVAPVSIGDGALVASGSVITEDVPADA
VAFGRARQDVKPGRAPILRERYEAEKAARKRAKAAE