Protein Info for SMc00228 in Sinorhizobium meliloti 1021

Annotation: ATP-dependent DNA helicase RecG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 701 PF17191: RecG_wedge" amino acids 30 to 182 (153 residues), 33.4 bits, see alignment E=1.1e-11 TIGR00643: ATP-dependent DNA helicase RecG" amino acids 41 to 664 (624 residues), 679.9 bits, see alignment E=2.2e-208 PF01336: tRNA_anti-codon" amino acids 70 to 146 (77 residues), 31.2 bits, see alignment E=6e-11 PF04851: ResIII" amino acids 273 to 431 (159 residues), 42.1 bits, see alignment E=3.2e-14 PF00270: DEAD" amino acids 276 to 435 (160 residues), 82.7 bits, see alignment E=9.4e-27 PF00271: Helicase_C" amino acids 475 to 586 (112 residues), 60.8 bits, see alignment E=5.1e-20 PF19833: RecG_dom3_C" amino acids 616 to 682 (67 residues), 45.6 bits, see alignment E=2.1e-15

Best Hits

KEGG orthology group: K03655, ATP-dependent DNA helicase RecG [EC: 3.6.4.12] (inferred from 100% identity to smk:Sinme_1557)

Predicted SEED Role

"ATP-dependent DNA helicase RecG (EC 3.6.1.-)" in subsystem DNA-replication (EC 3.6.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-, 3.6.4.12

Use Curated BLAST to search for 3.6.1.- or 3.6.4.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92PS7 at UniProt or InterPro

Protein Sequence (701 amino acids)

>SMc00228 ATP-dependent DNA helicase RecG (Sinorhizobium meliloti 1021)
MRPALLDPLFSPLDTLPGIGPKTGELYARLLGRETVEDCRVVDLLFHIPHSLIDRRRQPG
IAHAPNGAIVTITGRVDRHQPAPSGRSNVPYRVFLHDETGELALTFFRVRGNWLEKALPI
DETVIVSGKVDWFNRRASMVHPDYMVRAAESENMPLVEPVYGLTAGLTSRPLRKSIEAAV
ARVPDLPEWLDEALLRQQGFKSAKESFQRLHEPRDETDIDAQAPARRRIAYDEFLAGQLS
LSLVRQRLRKVAGTPIHPTGRLSGPVIAALPFSLTNSQSAAVDEILADMSGADRMLRLLQ
GDVGSGKTAVALMAMLAAVESGGQAVLMAPTEILARQHHATLSRMAAPAGITIDILTGRT
KGKERDAILERIASGETQLVIGTHALFQDAVIYRQLVLAVVDEQHRFGVHQRLRLTAKGI
SPHMLVMTATPIPRTLVLAAFGDMDVSKLTEKPAGRKPIQTVTIPNERTDEIVERLDAAL
RQGKKAYWICPLVEESEETDAMSADERYQSLARRFGKDVGLVHGRMAGPEKDAVMLAFKN
GEIRLLVATTVVEVGVDVPDATIMVIEHAERFGLAQLHQLRGRVGRGDEASTCILLYKSP
LSEAGRARLSVLRESEDGFLIAEEDLKLRGEGELLGTRQSGTPGFLIASLEAHADLLEMA
RKDAAYVIDRDPELTSERGQALRTLLYLFRRDEAIRFLRAG