Protein Info for SMc00188 in Sinorhizobium meliloti 1021

Annotation: cytochrome B transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 426 transmembrane" amino acids 44 to 71 (28 residues), see Phobius details amino acids 92 to 116 (25 residues), see Phobius details amino acids 127 to 149 (23 residues), see Phobius details amino acids 155 to 176 (22 residues), see Phobius details amino acids 196 to 216 (21 residues), see Phobius details amino acids 247 to 269 (23 residues), see Phobius details amino acids 290 to 307 (18 residues), see Phobius details amino acids 313 to 332 (20 residues), see Phobius details amino acids 344 to 364 (21 residues), see Phobius details amino acids 371 to 397 (27 residues), see Phobius details PF00033: Cytochrome_B" amino acids 33 to 220 (188 residues), 242.5 bits, see alignment E=4.8e-76 PF13631: Cytochrom_B_N_2" amino acids 103 to 271 (169 residues), 153.3 bits, see alignment E=9.7e-49 PF00032: Cytochrom_B_C" amino acids 276 to 384 (109 residues), 142.9 bits, see alignment E=5.6e-46

Best Hits

Swiss-Prot: 66% identical to CYB_BLAVI: Cytochrome b (petB) from Blastochloris viridis

KEGG orthology group: K00412, ubiquinol-cytochrome c reductase cytochrome b subunit [EC: 1.10.2.2] (inferred from 100% identity to smk:Sinme_1723)

MetaCyc: 54% identical to cytochrome bc1 complex cytochrome b subunit (Arabidopsis thaliana col)

Predicted SEED Role

"Ubiquinol--cytochrome c reductase, cytochrome B subunit (EC 1.10.2.2)" in subsystem Ubiquinone Menaquinone-cytochrome c reductase complexes (EC 1.10.2.2)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.10.2.2

Use Curated BLAST to search for 1.10.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92PE7 at UniProt or InterPro

Protein Sequence (426 amino acids)

>SMc00188 cytochrome B transmembrane protein (Sinorhizobium meliloti 1021)
MSADHSTYTPTTGIEKWVDSRLPLPRLVHDSFVSYPVPRNLNYAYTFGAMLSVMLIVQIL
TGIVLAMHYAAETSVAFNSVEKIMRDVNHGWLLRYLHANGASFFFIAVYLHIARGLYYGS
YKAPREILWILGVVIYLLMMATGFMGYVLPWGQMSFWGATVITGFFSAFPLVGEWIQQFL
LGGFAVDQPTLNRFFSLHYLLPFMIAGVVVLHIWALHVTGQTNPTGVEVKSKSDTVPFTP
YATLKDALGVSVFLIVYAWFVFYMPNFLGHPDNYIPADALKTPAHIVPEWYYLPFYAMLR
AITFNVGPIDSKLGGVLVMFGSILILFFLPWLDTSKVRSAVYRPWYKLFFWIFVADCILL
GWLGSRPAEGLYVVMSQLGTLYYFAFFLVIMPILGLIETPKRIPNSITEAVLEKQNAKAQ
LKPARA