Protein Info for SMc00180 in Sinorhizobium meliloti 1021

Annotation: coproporphyrinogen III oxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 PF01218: Coprogen_oxidas" amino acids 22 to 302 (281 residues), 284.6 bits, see alignment E=3e-89

Best Hits

Swiss-Prot: 100% identical to HEM6_RHIME: Oxygen-dependent coproporphyrinogen-III oxidase (hemF) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00228, coproporphyrinogen III oxidase [EC: 1.3.3.3] (inferred from 100% identity to smk:Sinme_1732)

Predicted SEED Role

"Coproporphyrinogen III oxidase, aerobic (EC 1.3.3.3)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 1.3.3.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.3.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92PD8 at UniProt or InterPro

Protein Sequence (303 amino acids)

>SMc00180 coproporphyrinogen III oxidase (Sinorhizobium meliloti 1021)
MERPQLPQGLPADIEDKKAAAKAWFESLRDTICAAFEAIEDELTGPLSDRPAGRFVAKDW
LREEGAGGGGRMSMMEGRVFEKVGVHTSTVFGEFSPEFREQIPGASEDPRFWASGISLIA
HPVNPNVPAVHMNTRMVVTTSNWFGGGADLTPVLDRRRIMTDPDTVLFHRAMEIACNRHP
VADHAKFKQWCDEYFYLKHRNEPRGTGGIFYDWLRSAEELGGWDADFAFTRDVGKAFALV
YPRIVRTNFNKPWTEQDRNEQLVRRGRYVEFNLLYDRGTIFGLKTGGNVESILSSLPPLV
RWP